Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   NMK57_RS17805 Genome accession   NZ_CP101305
Coordinates   3456749..3457378 (-) Length   209 a.a.
NCBI ID   WP_000841914.1    Uniprot ID   A0AAP9MNK0
Organism   Escherichia coli strain 2002-3211     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3403250..3457411 3456749..3457378 within 0


Gene organization within MGE regions


Location: 3403250..3457411
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NMK57_RS17460 (NMK57_17460) - 3403383..3403652 (-) 270 WP_001023407.1 phage tail fiber C-terminal domain-containing protein -
  NMK57_RS17465 (NMK57_17465) - 3403654..3404967 (-) 1314 WP_032212761.1 prophage tail fiber N-terminal domain-containing protein -
  NMK57_RS17470 (NMK57_17470) - 3405032..3405631 (-) 600 WP_001230497.1 Ail/Lom family outer membrane beta-barrel protein -
  NMK57_RS17475 (NMK57_17475) - 3405698..3409174 (-) 3477 WP_254856969.1 phage tail protein -
  NMK57_RS17480 (NMK57_17480) - 3409423..3410004 (-) 582 WP_001090037.1 tail assembly protein -
  NMK57_RS17485 (NMK57_17485) - 3410001..3410744 (-) 744 WP_032316709.1 C40 family peptidase -
  NMK57_RS17490 (NMK57_17490) - 3410755..3411453 (-) 699 WP_001365123.1 phage minor tail protein L -
  NMK57_RS17495 (NMK57_17495) - 3411453..3411782 (-) 330 WP_000847306.1 phage tail protein -
  NMK57_RS17500 (NMK57_17500) - 3411779..3414424 (-) 2646 WP_254856970.1 phage tail tape measure protein -
  NMK57_RS17505 (NMK57_17505) - 3414474..3414776 (-) 303 Protein_3452 phage tail assembly protein T -
  NMK57_RS17510 (NMK57_17510) gpG 3414803..3415225 (-) 423 WP_000479043.1 phage tail assembly chaperone G -
  NMK57_RS17515 (NMK57_17515) - 3415239..3415991 (-) 753 WP_000235098.1 phage tail protein -
  NMK57_RS17520 (NMK57_17520) gpU 3415999..3416397 (-) 399 WP_000682716.1 phage tail terminator protein -
  NMK57_RS17525 (NMK57_17525) - 3416410..3417033 (-) 624 WP_000974958.1 phage tail protein -
  NMK57_RS17530 (NMK57_17530) - 3417036..3417317 (-) 282 WP_001281348.1 DNA breaking-rejoining protein -
  NMK57_RS17535 (NMK57_17535) - 3417310..3417636 (-) 327 WP_001097065.1 DUF2190 family protein -
  NMK57_RS17540 (NMK57_17540) - 3417724..3419748 (-) 2025 WP_001114424.1 ClpP-like prohead protease/major capsid protein fusion protein -
  NMK57_RS17545 (NMK57_17545) - 3419693..3421195 (-) 1503 WP_000974564.1 phage portal protein -
  NMK57_RS17550 (NMK57_17550) - 3421195..3421407 (-) 213 WP_000102415.1 hypothetical protein -
  NMK57_RS17555 (NMK57_17555) - 3421404..3423527 (-) 2124 WP_001077625.1 phage terminase large subunit family protein -
  NMK57_RS17560 (NMK57_17560) - 3423524..3424000 (-) 477 WP_000373410.1 DUF1441 family protein -
  NMK57_RS17565 (NMK57_17565) - 3424477..3424662 (-) 186 WP_012816791.1 Rz1 family lipoprotein -
  NMK57_RS17570 (NMK57_17570) - 3424890..3425036 (-) 147 WP_000539792.1 hypothetical protein -
  NMK57_RS17575 (NMK57_17575) - 3425036..3425605 (-) 570 WP_001056806.1 phage antirepressor N-terminal domain-containing protein -
  NMK57_RS17580 (NMK57_17580) - 3425876..3426409 (-) 534 WP_000087730.1 lysozyme -
  NMK57_RS17585 (NMK57_17585) - 3426414..3426629 (-) 216 WP_000284506.1 class II holin family protein -
  NMK57_RS17590 (NMK57_17590) - 3426706..3426951 (-) 246 WP_001290233.1 DUF826 domain-containing protein -
  NMK57_RS17595 (NMK57_17595) - 3426992..3427171 (-) 180 WP_000142777.1 DUF1378 family protein -
  NMK57_RS17600 (NMK57_17600) - 3427308..3429254 (-) 1947 WP_254856971.1 DUF6645 domain-containing protein -
  NMK57_RS17605 (NMK57_17605) iraM 3429554..3429880 (+) 327 WP_001443281.1 anti-adapter protein IraM -
  NMK57_RS17610 (NMK57_17610) - 3430476..3431552 (-) 1077 WP_000024329.1 site-specific DNA-methyltransferase -
  NMK57_RS17615 (NMK57_17615) - 3431704..3431901 (-) 198 WP_000917767.1 hypothetical protein -
  NMK57_RS17620 (NMK57_17620) - 3432143..3432673 (-) 531 WP_000640048.1 DUF1133 family protein -
  NMK57_RS17625 (NMK57_17625) - 3432682..3433041 (-) 360 WP_000904103.1 RusA family crossover junction endodeoxyribonuclease -
  NMK57_RS17630 (NMK57_17630) - 3433054..3434103 (-) 1050 WP_001265133.1 DUF968 domain-containing protein -
  NMK57_RS17635 (NMK57_17635) - 3434105..3434383 (-) 279 WP_072145984.1 hypothetical protein -
  NMK57_RS17640 (NMK57_17640) hokD 3434551..3434706 (-) 156 WP_000813263.1 type I toxin-antitoxin system toxin HokD -
  NMK57_RS17645 (NMK57_17645) - 3434952..3435056 (-) 105 WP_001278454.1 hypothetical protein -
  NMK57_RS27635 - 3435172..3435783 (-) 612 WP_306308425.1 DUF551 domain-containing protein -
  NMK57_RS17655 (NMK57_17655) - 3435916..3436041 (-) 126 Protein_3482 hypothetical protein -
  NMK57_RS17660 (NMK57_17660) - 3436052..3436315 (-) 264 WP_000224233.1 hypothetical protein -
  NMK57_RS17665 (NMK57_17665) - 3436317..3436534 (-) 218 Protein_3484 DUF4014 family protein -
  NMK57_RS17670 (NMK57_17670) - 3436567..3436779 (-) 213 WP_000935420.1 hypothetical protein -
  NMK57_RS17675 (NMK57_17675) - 3436830..3437186 (-) 357 WP_000403777.1 hypothetical protein -
  NMK57_RS17680 (NMK57_17680) - 3437164..3437625 (-) 462 WP_001209480.1 sigma-E factor regulatory protein RseB domain-containing protein -
  NMK57_RS17685 (NMK57_17685) - 3437622..3437918 (-) 297 WP_001266134.1 DUF4406 domain-containing protein -
  NMK57_RS17690 (NMK57_17690) - 3437915..3438337 (-) 423 WP_001151153.1 DUF977 family protein -
  NMK57_RS17695 (NMK57_17695) - 3438378..3439448 (-) 1071 WP_001262384.1 hypothetical protein -
  NMK57_RS17700 (NMK57_17700) - 3439520..3439945 (-) 426 WP_000693884.1 toxin YdaT family protein -
  NMK57_RS17705 (NMK57_17705) ydaS 3439968..3440264 (-) 297 WP_000712069.1 toxin YdaS -
  NMK57_RS17710 (NMK57_17710) racR 3440388..3440864 (+) 477 WP_000948459.1 DNA-binding transcriptional repressor RacR -
  NMK57_RS17715 (NMK57_17715) - 3441180..3441332 (+) 153 WP_000379585.1 DUF1391 family protein -
  NMK57_RS17720 (NMK57_17720) - 3441344..3441733 (+) 390 WP_000394568.1 hypothetical protein -
  NMK57_RS17725 (NMK57_17725) dicB 3442479..3442661 (+) 183 WP_000449182.1 cell division inhibition protein DicB -
  NMK57_RS17730 (NMK57_17730) - 3442664..3442867 (+) 204 WP_001098749.1 DUF1482 family protein -
  NMK57_RS17735 (NMK57_17735) - 3442948..3445383 (+) 2436 WP_032212635.1 exonuclease -
  NMK57_RS17740 (NMK57_17740) - 3445451..3445693 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  NMK57_RS17745 (NMK57_17745) - 3445671..3446690 (+) 1020 WP_001299351.1 tyrosine-type recombinase/integrase -
  NMK57_RS17750 (NMK57_17750) yccA 3447098..3447757 (+) 660 WP_000375136.1 FtsH protease modulator YccA -
  NMK57_RS17755 (NMK57_17755) tusE 3447848..3448177 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  NMK57_RS17760 (NMK57_17760) yccX 3448174..3448452 (-) 279 WP_000048233.1 acylphosphatase -
  NMK57_RS17765 (NMK57_17765) rlmI 3448547..3449737 (+) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  NMK57_RS17770 (NMK57_17770) hspQ 3449795..3450112 (+) 318 WP_001295356.1 heat shock protein HspQ -
  NMK57_RS17775 (NMK57_17775) yccU 3450157..3450570 (-) 414 WP_000665217.1 CoA-binding protein -
  NMK57_RS17780 (NMK57_17780) yccT 3450743..3451405 (+) 663 WP_000847791.1 DUF2057 family protein -
  NMK57_RS17785 (NMK57_17785) mgsA 3451501..3451959 (+) 459 WP_000424181.1 methylglyoxal synthase -
  NMK57_RS17790 (NMK57_17790) helD 3451991..3454045 (-) 2055 WP_001295354.1 DNA helicase IV -
  NMK57_RS17795 (NMK57_17795) yccF 3454168..3454614 (+) 447 WP_001261235.1 YccF domain-containing protein -
  NMK57_RS17800 (NMK57_17800) yccS 3454624..3456786 (+) 2163 WP_000875061.1 YccS family putative transporter -
  NMK57_RS17805 (NMK57_17805) sxy/tfoX 3456749..3457378 (-) 630 WP_000841914.1 CRP-S regulon transcriptional coactivator Sxy Regulator

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24130.97 Da        Isoelectric Point: 9.2180

>NTDB_id=709586 NMK57_RS17805 WP_000841914.1 3456749..3457378(-) (sxy/tfoX) [Escherichia coli strain 2002-3211]
MKSPSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=709586 NMK57_RS17805 WP_000841914.1 3456749..3457378(-) (sxy/tfoX) [Escherichia coli strain 2002-3211]
ATGAAAAGCCCCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.522

100

0.995