NTDB

Overview

Name	abrB	Type	Regulator
Locus tag	NLJ82_RS17765	Genome accession	NZ_CP101135
Coordinates	3456924..3457202 (-)	Length	92 a.a.
NCBI ID	WP_061185067.1	Uniprot ID	-
Organism	Bacillus paranthracis strain Bt C4
Function	repression of comK; repression of rok (predicted from homology) Competence regulation

Genomic Context

Location: 3451924..3462202

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NLJ82_RS17720 (NLJ82_17720)	-	3452183..3452458 (-)	276	WP_061185060.1	hypothetical protein	-
NLJ82_RS17725 (NLJ82_17725)	-	3452556..3452819 (-)	264	WP_061185061.1	hypothetical protein	-
NLJ82_RS17730 (NLJ82_17730)	-	3453065..3453313 (+)	249	WP_061185062.1	hypothetical protein	-
NLJ82_RS17735 (NLJ82_17735)	-	3455003..3455302 (+)	300	WP_061185063.1	lactate permease	-
NLJ82_RS17740 (NLJ82_17740)	-	3455299..3455514 (-)	216	WP_061185064.1	hypothetical protein	-
NLJ82_RS17745 (NLJ82_17745)	-	3455606..3456088 (-)	483	WP_061185065.1	nucleoside triphosphate pyrophosphohydrolase family protein	-
NLJ82_RS17750 (NLJ82_17750)	-	3456108..3456359 (-)	252	WP_254754542.1	helix-turn-helix domain containing protein	-
NLJ82_RS17755 (NLJ82_17755)	-	3456385..3456552 (-)	168	WP_000717826.1	DUF3954 domain-containing protein	-
NLJ82_RS17760 (NLJ82_17760)	-	3456572..3456931 (-)	360	WP_001125952.1	hypothetical protein	-
NLJ82_RS17765 (NLJ82_17765)	abrB	3456924..3457202 (-)	279	WP_061185067.1	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	Regulator
NLJ82_RS17770 (NLJ82_17770)	-	3457218..3457412 (-)	195	WP_061185068.1	hypothetical protein	-
NLJ82_RS17775 (NLJ82_17775)	-	3457415..3458278 (-)	864	WP_061185069.1	ATP-binding protein	-
NLJ82_RS17780 (NLJ82_17780)	-	3458226..3459005 (-)	780	WP_254754544.1	DnaD domain protein	-
NLJ82_RS17785 (NLJ82_17785)	-	3459010..3459186 (-)	177	WP_061185071.1	hypothetical protein	-
NLJ82_RS17790 (NLJ82_17790)	-	3459216..3459380 (-)	165	WP_061185072.1	hypothetical protein	-
NLJ82_RS17795 (NLJ82_17795)	-	3459393..3459653 (-)	261	WP_061185073.1	group-specific protein	-
NLJ82_RS17800 (NLJ82_17800)	-	3459685..3460416 (-)	732	WP_061185074.1	ORF6C domain-containing protein	-
NLJ82_RS17805 (NLJ82_17805)	-	3460486..3460689 (-)	204	WP_000593840.1	helix-turn-helix domain-containing protein	-
NLJ82_RS17810 (NLJ82_17810)	-	3460889..3461236 (+)	348	WP_001015177.1	helix-turn-helix domain-containing protein	-
NLJ82_RS17815 (NLJ82_17815)	-	3461242..3461391 (-)	150	WP_201027916.1	hypothetical protein	-
NLJ82_RS17820 (NLJ82_17820)	-	3461554..3461709 (-)	156	WP_000757193.1	hypothetical protein	-

Sequence

Protein

Download Length: 92 a.a. Molecular weight: 10163.68 Da Isoelectric Point: 5.1716

                                >NTDB_id=709033 NLJ82_RS17765 WP_061185067.1 3456924..3457202(-) (abrB) [Bacillus paranthracis strain Bt C4]

MKNTGVARNVDELGRVVIPVELRRTLGIAEGTALDFHVDGENIVLRKHEKSCFVTGEVSESNMELLDGRMFLSKEGATEL

LDILEKSVKVHA

Nucleotide

Download Length: 279 bp

                                >NTDB_id=709033 NLJ82_RS17765 WP_061185067.1 3456924..3457202(-) (abrB) [Bacillus paranthracis strain Bt C4]

ATGAAAAATACAGGTGTTGCAAGAAATGTAGATGAGCTAGGGCGTGTAGTAATTCCGGTAGAGTTACGCAGAACTTTAGG

GATTGCTGAAGGAACGGCATTAGACTTTCATGTTGACGGGGAAAACATCGTTTTAAGAAAACATGAAAAGTCATGTTTTG

TAACAGGTGAAGTTTCTGAATCAAACATGGAATTGCTAGATGGAAGAATGTTTCTAAGTAAAGAAGGAGCAACTGAATTA

CTGGACATTCTTGAAAAGAGTGTGAAGGTACATGCCTAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(52-86)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(10-49)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
abrB	Bacillus subtilis subsp. subtilis str. 168	59.036	90.217	0.533

Detailed information NTG0709033