Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NL113_RS18680 Genome accession   NZ_CP101130
Coordinates   3728015..3728191 (-) Length   58 a.a.
NCBI ID   WP_029419380.1    Uniprot ID   A0A7Y8RZ87
Organism   Bacillus sp. KRF7     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3723015..3733191
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NL113_RS18635 comGE 3723283..3723630 (+) 348 WP_006637536.1 competence type IV pilus minor pilin ComGE -
  NL113_RS18640 comGF 3723539..3724030 (+) 492 WP_224254419.1 competence type IV pilus minor pilin ComGF -
  NL113_RS18645 comGG 3724085..3724408 (+) 324 WP_224254418.1 competence type IV pilus minor pilin ComGG -
  NL113_RS18650 - 3724488..3724673 (+) 186 WP_006637533.1 YqzE family protein -
  NL113_RS18655 - 3724767..3725087 (-) 321 WP_006637532.1 DUF3889 domain-containing protein -
  NL113_RS18660 tapA 3725350..3726096 (+) 747 WP_006637531.1 amyloid fiber anchoring/assembly protein TapA -
  NL113_RS18665 sipW 3726093..3726674 (+) 582 WP_006637530.1 signal peptidase I SipW -
  NL113_RS18670 tasA 3726744..3727538 (+) 795 WP_006637529.1 biofilm matrix protein TasA -
  NL113_RS18675 sinR 3727646..3727981 (-) 336 WP_006637528.1 transcriptional regulator SinR Regulator
  NL113_RS18680 sinI 3728015..3728191 (-) 177 WP_029419380.1 anti-repressor SinI Regulator
  NL113_RS18685 - 3728378..3729172 (-) 795 WP_006637526.1 YqhG family protein -
  NL113_RS18690 - 3729176..3730855 (-) 1680 WP_006637525.1 DEAD/DEAH box helicase -
  NL113_RS18695 gcvT 3731442..3732536 (+) 1095 WP_006637524.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6635.57 Da        Isoelectric Point: 5.6746

>NTDB_id=708991 NL113_RS18680 WP_029419380.1 3728015..3728191(-) (sinI) [Bacillus sp. KRF7]
MMKAKSEKEELDKEWEDLIKSALRAGISPEEIRIFLNLGHKPSEASTPIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=708991 NL113_RS18680 WP_029419380.1 3728015..3728191(-) (sinI) [Bacillus sp. KRF7]
ATCATGAAAGCGAAAAGTGAGAAGGAAGAATTGGACAAGGAGTGGGAAGATCTCATCAAAAGCGCTCTCAGAGCAGGTAT
TAGTCCAGAGGAAATAAGAATTTTTCTCAATTTGGGTCATAAGCCTTCGGAAGCTTCCACACCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A7Y8RZ87

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517