Detailed information    

insolico Bioinformatically predicted

Overview

Name   recN   Type   Machinery gene
Locus tag   NMD80_RS03615 Genome accession   NZ_CP100817
Coordinates   787704..787874 (-) Length   56 a.a.
NCBI ID   WP_370559218.1    Uniprot ID   -
Organism   Edwardsiella tarda strain GT63     
Function   homologous recombination (predicted from homology)   
Homologous recombination

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 765650..787874 787704..787874 within 0


Gene organization within MGE regions


Location: 765650..787874
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NMD80_RS03505 (NMD80_03510) - 765650..766189 (+) 540 WP_078000005.1 fimbrial protein -
  NMD80_RS03510 (NMD80_03515) faeD 766289..768655 (+) 2367 WP_370559703.1 F4 (K88) fimbrial usher FaeD -
  NMD80_RS03515 (NMD80_03520) - 768669..769436 (+) 768 WP_139355397.1 fimbria/pilus periplasmic chaperone -
  NMD80_RS03520 (NMD80_03525) - 769471..769974 (+) 504 WP_370559210.1 DUF5462 family protein -
  NMD80_RS03525 (NMD80_03530) - 770202..771017 (+) 816 WP_370556258.1 fimbrial protein -
  NMD80_RS03530 (NMD80_03535) - 771231..772022 (+) 792 WP_035605268.1 fimbrial protein -
  NMD80_RS03535 (NMD80_03540) - 772048..772812 (+) 765 WP_370559211.1 fimbrial protein -
  NMD80_RS03540 (NMD80_03545) - 772932..773228 (-) 297 WP_068871720.1 YciI family protein -
  NMD80_RS03545 (NMD80_03550) - 773752..775173 (+) 1422 WP_370559212.1 NCS1 family nucleobase:cation symporter-1 -
  NMD80_RS03550 (NMD80_03555) - 775487..775879 (-) 393 WP_370559213.1 hypothetical protein -
  NMD80_RS03555 (NMD80_03560) - 776326..777272 (-) 947 Protein_685 IS30 family transposase -
  NMD80_RS03560 (NMD80_03565) - 778101..778313 (+) 213 WP_370559214.1 helix-turn-helix domain-containing protein -
  NMD80_RS03565 (NMD80_03570) - 778310..779176 (+) 867 WP_370559215.1 hypothetical protein -
  NMD80_RS03570 (NMD80_03575) - 779207..780667 (-) 1461 WP_370559216.1 Eco57I restriction-modification methylase domain-containing protein -
  NMD80_RS03575 (NMD80_03580) tnpA 781925..782362 (+) 438 WP_370559704.1 IS200/IS605 family transposase -
  NMD80_RS03580 (NMD80_03585) - 782431..783660 (-) 1230 WP_370559705.1 integrase domain-containing protein -
  NMD80_RS03590 (NMD80_03595) smpB 784238..784675 (-) 438 WP_370559217.1 SsrA-binding protein SmpB -
  NMD80_RS03595 (NMD80_03600) - 784873..785307 (+) 435 WP_005289436.1 type II toxin-antitoxin system RatA family toxin -
  NMD80_RS03600 (NMD80_03605) - 785309..785587 (+) 279 WP_005289435.1 RnfH family protein -
  NMD80_RS03605 (NMD80_03610) bamE 785659..786015 (-) 357 WP_370548233.1 outer membrane protein assembly factor BamE -
  NMD80_RS03610 (NMD80_03615) recN 786215..787684 (-) 1470 WP_370559706.1 DNA repair protein RecN -
  NMD80_RS03615 recN 787704..787874 (-) 171 WP_370559218.1 AAA family ATPase Machinery gene

Sequence

Protein


Download         Length: 56 a.a.        Molecular weight: 5880.85 Da        Isoelectric Point: 4.6716

>NTDB_id=707102 NMD80_RS03615 WP_370559218.1 787704..787874(-) (recN) [Edwardsiella tarda strain GT63]
MLTQLTISNFAIVRELEIDFQRGMTAITGETGAGKSIAIDALTLCLGGAARPPWCG

Nucleotide


Download         Length: 171 bp        

>NTDB_id=707102 NMD80_RS03615 WP_370559218.1 787704..787874(-) (recN) [Edwardsiella tarda strain GT63]
ATGCTGACGCAGCTCACCATATCCAACTTTGCCATCGTGCGGGAACTGGAGATCGACTTCCAGCGCGGGATGACCGCCAT
TACCGGGGAAACCGGCGCCGGTAAATCCATCGCCATCGACGCCCTCACCCTCTGCCTCGGGGGCGCAGCGAGGCCGCCAT
GGTGCGGATGA

Domains

Predicted by InterproScan.

AAA domain (AAA_23)

(4-50)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  recN Bacillus subtilis subsp. subtilis str. 168

62.5

85.714

0.536