Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   NLW79_RS13505 Genome accession   NZ_CP100651
Coordinates   2612885..2613232 (-) Length   115 a.a.
NCBI ID   WP_254517746.1    Uniprot ID   -
Organism   Bacillus halotolerans strain MEC_B334     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2607885..2618232
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NLW79_RS13460 (NLW79_13460) sinI 2608410..2608583 (+) 174 WP_024122036.1 anti-repressor SinI Regulator
  NLW79_RS13465 (NLW79_13465) sinR 2608617..2608952 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NLW79_RS13470 (NLW79_13470) tasA 2609039..2609824 (-) 786 WP_106020091.1 biofilm matrix protein TasA -
  NLW79_RS13475 (NLW79_13475) sipW 2609889..2610473 (-) 585 WP_105955579.1 signal peptidase I SipW -
  NLW79_RS13480 (NLW79_13480) tapA 2610445..2611206 (-) 762 WP_106020093.1 amyloid fiber anchoring/assembly protein TapA -
  NLW79_RS13485 (NLW79_13485) - 2611484..2611807 (+) 324 WP_024122040.1 YqzG/YhdC family protein -
  NLW79_RS13490 (NLW79_13490) - 2611850..2612029 (-) 180 WP_003236949.1 YqzE family protein -
  NLW79_RS13495 (NLW79_13495) comGG 2612101..2612475 (-) 375 WP_106020094.1 competence type IV pilus minor pilin ComGG Machinery gene
  NLW79_RS13500 (NLW79_13500) comGF 2612476..2612859 (-) 384 WP_038954226.1 competence type IV pilus minor pilin ComGF Machinery gene
  NLW79_RS13505 (NLW79_13505) comGE 2612885..2613232 (-) 348 WP_254517746.1 competence type IV pilus minor pilin ComGE Machinery gene
  NLW79_RS13510 (NLW79_13510) comGD 2613216..2613647 (-) 432 WP_044154579.1 competence type IV pilus minor pilin ComGD Machinery gene
  NLW79_RS13515 (NLW79_13515) comGC 2613637..2613933 (-) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  NLW79_RS13520 (NLW79_13520) comGB 2613947..2614984 (-) 1038 WP_127696769.1 competence type IV pilus assembly protein ComGB Machinery gene
  NLW79_RS13525 (NLW79_13525) comGA 2614971..2616041 (-) 1071 WP_095713275.1 competence protein ComGA Machinery gene
  NLW79_RS13530 (NLW79_13530) - 2616362..2616772 (-) 411 WP_254517748.1 CBS domain-containing protein -
  NLW79_RS13535 (NLW79_13535) - 2616835..2617788 (-) 954 WP_095713277.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13221.06 Da        Isoelectric Point: 4.3566

>NTDB_id=706013 NLW79_RS13505 WP_254517746.1 2612885..2613232(-) (comGE) [Bacillus halotolerans strain MEC_B334]
MWRENKGFSTIETMAALSIWLFMLLTIVPLWNKLIADEHIAESREIGYQLVNESIGKYMLTGAGDSSQTVSMNNSKYSMT
WEEEGEYQNVCITSDAYKDKPFCLSILRTDWLYAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=706013 NLW79_RS13505 WP_254517746.1 2612885..2613232(-) (comGE) [Bacillus halotolerans strain MEC_B334]
ATGTGGAGAGAAAATAAAGGCTTTTCTACAATTGAAACAATGGCTGCCCTCAGCATATGGCTCTTTATGCTTCTGACGAT
CGTGCCGTTGTGGAACAAGCTGATAGCTGATGAACATATAGCGGAGTCGAGAGAAATTGGTTATCAGCTTGTTAATGAAA
GCATAGGCAAATATATGCTGACAGGAGCAGGAGATTCGTCACAAACTGTTTCGATGAACAATAGCAAATACTCGATGACA
TGGGAGGAGGAGGGAGAGTATCAAAACGTATGCATCACATCAGACGCCTATAAAGACAAGCCATTTTGCCTCAGCATTTT
GCGGACAGACTGGCTATACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

71.304

100

0.713