Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NLK52_RS12115 Genome accession   NZ_CP100436
Coordinates   2373153..2373326 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain MEC_B298     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2368153..2378326
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NLK52_RS12100 (NLK52_12100) gcvT 2368952..2370040 (-) 1089 WP_015384081.1 glycine cleavage system aminomethyltransferase GcvT -
  NLK52_RS12105 (NLK52_12105) hepAA 2370482..2372155 (+) 1674 WP_015384082.1 DEAD/DEAH box helicase -
  NLK52_RS12110 (NLK52_12110) yqhG 2372176..2372970 (+) 795 WP_003230200.1 YqhG family protein -
  NLK52_RS12115 (NLK52_12115) sinI 2373153..2373326 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NLK52_RS12120 (NLK52_12120) sinR 2373360..2373695 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NLK52_RS12125 (NLK52_12125) tasA 2373788..2374573 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  NLK52_RS12130 (NLK52_12130) sipW 2374637..2375209 (-) 573 WP_080030740.1 signal peptidase I SipW -
  NLK52_RS12135 (NLK52_12135) tapA 2375193..2375954 (-) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  NLK52_RS12140 (NLK52_12140) yqzG 2376224..2376550 (+) 327 WP_015384086.1 YqzG/YhdC family protein -
  NLK52_RS12145 (NLK52_12145) spoIITA 2376592..2376771 (-) 180 WP_003230176.1 YqzE family protein -
  NLK52_RS12150 (NLK52_12150) comGG 2376843..2377217 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  NLK52_RS12155 (NLK52_12155) comGF 2377218..2377601 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  NLK52_RS12160 (NLK52_12160) comGE 2377627..2377974 (-) 348 WP_015384088.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=705431 NLK52_RS12115 WP_003230187.1 2373153..2373326(+) (sinI) [Bacillus subtilis strain MEC_B298]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=705431 NLK52_RS12115 WP_003230187.1 2373153..2373326(+) (sinI) [Bacillus subtilis strain MEC_B298]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1