Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NJ242_RS07815 Genome accession   NZ_CP100391
Coordinates   1496557..1496730 (-) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain PHP1601     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1491557..1501730
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NJ242_RS07765 (NJ242_07765) comGD 1491676..1492113 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  NJ242_RS07770 (NJ242_07770) comGE 1492097..1492411 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  NJ242_RS07775 (NJ242_07775) comGF 1492356..1492820 (+) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  NJ242_RS07780 (NJ242_07780) comGG 1492821..1493198 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  NJ242_RS07785 (NJ242_07785) - 1493255..1493434 (+) 180 WP_022552966.1 YqzE family protein -
  NJ242_RS07790 (NJ242_07790) - 1493475..1493804 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  NJ242_RS07795 (NJ242_07795) tapA 1494063..1494734 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  NJ242_RS07800 (NJ242_07800) sipW 1494706..1495290 (+) 585 WP_032874025.1 signal peptidase I SipW -
  NJ242_RS07805 (NJ242_07805) tasA 1495355..1496140 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  NJ242_RS07810 (NJ242_07810) sinR 1496188..1496523 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NJ242_RS07815 (NJ242_07815) sinI 1496557..1496730 (-) 174 WP_032874029.1 anti-repressor SinI Regulator
  NJ242_RS07820 (NJ242_07820) - 1496907..1497701 (-) 795 WP_007612541.1 YqhG family protein -
  NJ242_RS07825 (NJ242_07825) - 1497723..1499393 (-) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  NJ242_RS07830 (NJ242_07830) gcvT 1499816..1500916 (+) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=704863 NJ242_RS07815 WP_032874029.1 1496557..1496730(-) (sinI) [Bacillus velezensis strain PHP1601]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=704863 NJ242_RS07815 WP_032874029.1 1496557..1496730(-) (sinI) [Bacillus velezensis strain PHP1601]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719