Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NHG72_RS17985 Genome accession   NZ_CP100041
Coordinates   3611623..3611796 (-) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain B3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3606623..3616796
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NHG72_RS17935 (NHG72_17900) comGD 3606742..3607179 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  NHG72_RS17940 (NHG72_17905) comGE 3607163..3607477 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  NHG72_RS17945 (NHG72_17910) comGF 3607386..3607886 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  NHG72_RS17950 (NHG72_17915) comGG 3607887..3608264 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  NHG72_RS17955 (NHG72_17920) - 3608321..3608500 (+) 180 WP_022552966.1 YqzE family protein -
  NHG72_RS17960 (NHG72_17925) - 3608541..3608870 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  NHG72_RS17965 (NHG72_17930) tapA 3609129..3609800 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  NHG72_RS17970 (NHG72_17935) sipW 3609772..3610356 (+) 585 WP_032874025.1 signal peptidase I SipW -
  NHG72_RS17975 (NHG72_17940) tasA 3610421..3611206 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  NHG72_RS17980 (NHG72_17945) sinR 3611254..3611589 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NHG72_RS17985 (NHG72_17950) sinI 3611623..3611796 (-) 174 WP_032874029.1 anti-repressor SinI Regulator
  NHG72_RS17990 (NHG72_17955) - 3611973..3612767 (-) 795 WP_007612541.1 YqhG family protein -
  NHG72_RS17995 (NHG72_17960) - 3612789..3614459 (-) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  NHG72_RS18000 (NHG72_17965) gcvT 3614882..3615982 (+) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=703442 NHG72_RS17985 WP_032874029.1 3611623..3611796(-) (sinI) [Bacillus velezensis strain B3]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=703442 NHG72_RS17985 WP_032874029.1 3611623..3611796(-) (sinI) [Bacillus velezensis strain B3]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719