Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   NHG71_RS03970 Genome accession   NZ_CP100040
Coordinates   739881..740195 (+) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain B1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 734881..745195
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NHG71_RS03945 (NHG71_03925) - 735916..736866 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  NHG71_RS03950 (NHG71_03930) comGA 737063..738133 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  NHG71_RS03955 (NHG71_03935) comGB 738120..739157 (+) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  NHG71_RS03960 (NHG71_03940) comGC 739162..739470 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  NHG71_RS03965 (NHG71_03945) comGD 739460..739897 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  NHG71_RS03970 (NHG71_03950) comGE 739881..740195 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  NHG71_RS03975 (NHG71_03955) comGF 740140..740604 (+) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  NHG71_RS03980 (NHG71_03960) comGG 740605..740982 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  NHG71_RS03985 (NHG71_03965) - 741039..741218 (+) 180 WP_022552966.1 YqzE family protein -
  NHG71_RS03990 (NHG71_03970) - 741259..741588 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  NHG71_RS03995 (NHG71_03975) tapA 741847..742518 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  NHG71_RS04000 (NHG71_03980) sipW 742490..743074 (+) 585 WP_032874025.1 signal peptidase I SipW -
  NHG71_RS04005 (NHG71_03985) tasA 743139..743924 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  NHG71_RS04010 (NHG71_03990) sinR 743972..744307 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NHG71_RS04015 (NHG71_03995) sinI 744341..744514 (-) 174 WP_032874029.1 anti-repressor SinI Regulator

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=703314 NHG71_RS03970 WP_032874016.1 739881..740195(+) (comGE) [Bacillus velezensis strain B1]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=703314 NHG71_RS03970 WP_032874016.1 739881..740195(+) (comGE) [Bacillus velezensis strain B1]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481