Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   NEE09_RS08510 Genome accession   NZ_CP099641
Coordinates   1639403..1639552 (-) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain ATCC 700671     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 1635319..1641223 1639403..1639552 within 0


Gene organization within MGE regions


Location: 1635319..1641223
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NEE09_RS08485 - 1635319..1636665 (-) 1347 WP_025168898.1 IS1380-like element ISSpn5 family transposase -
  NEE09_RS08490 blpZ 1636996..1637229 (-) 234 WP_000276498.1 immunity protein BlpZ -
  NEE09_RS08495 - 1637271..1637960 (-) 690 WP_000760521.1 CPBP family intramembrane glutamic endopeptidase -
  NEE09_RS08500 - 1637975..1638394 (-) 420 WP_000877385.1 hypothetical protein -
  NEE09_RS08505 - 1639180..1639299 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  NEE09_RS08510 cipB 1639403..1639552 (-) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  NEE09_RS08515 blpN 1639796..1639999 (-) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  NEE09_RS08520 blpM 1640015..1640269 (-) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  NEE09_RS08525 - 1640419..1641223 (-) 805 Protein_1634 IS5 family transposase -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=701219 NEE09_RS08510 WP_001809846.1 1639403..1639552(-) (cipB) [Streptococcus pneumoniae strain ATCC 700671]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=701219 NEE09_RS08510 WP_001809846.1 1639403..1639552(-) (cipB) [Streptococcus pneumoniae strain ATCC 700671]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531