Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   NC516_RS06945 Genome accession   NZ_CP099485
Coordinates   1377463..1377768 (-) Length   101 a.a.
NCBI ID   WP_016265375.1    Uniprot ID   A0A9N7J126
Organism   Latilactobacillus sakei strain WiKim0095     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1372463..1382768
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NC516_RS06910 (NC516_06910) - 1372902..1373267 (+) 366 WP_011374991.1 DUF805 domain-containing protein -
  NC516_RS06920 (NC516_06920) - 1373810..1374268 (-) 459 WP_035145008.1 hypothetical protein -
  NC516_RS06925 (NC516_06925) - 1374323..1375519 (-) 1197 WP_011374993.1 acetate kinase -
  NC516_RS06930 (NC516_06930) - 1375541..1376551 (-) 1011 WP_016265372.1 class I SAM-dependent methyltransferase -
  NC516_RS06935 (NC516_06935) - 1376675..1377013 (-) 339 WP_035145011.1 hypothetical protein -
  NC516_RS06940 (NC516_06940) comGF 1376976..1377488 (-) 513 WP_035145013.1 competence type IV pilus minor pilin ComGF Machinery gene
  NC516_RS06945 (NC516_06945) comGE 1377463..1377768 (-) 306 WP_016265375.1 hypothetical protein Machinery gene
  NC516_RS06950 (NC516_06950) comGD 1377755..1378207 (-) 453 WP_105300046.1 competence type IV pilus minor pilin ComGD Machinery gene
  NC516_RS06955 (NC516_06955) comGC 1378179..1378478 (-) 300 WP_025016383.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  NC516_RS06960 (NC516_06960) comGB 1378475..1379134 (-) 660 WP_252814889.1 type II secretion system F family protein Machinery gene
  NC516_RS06965 (NC516_06965) comGB 1379152..1379481 (-) 330 WP_252814890.1 type II secretion system F family protein Machinery gene
  NC516_RS06970 (NC516_06970) comGA 1379474..1380364 (-) 891 WP_025016380.1 competence type IV pilus ATPase ComGA Machinery gene
  NC516_RS06975 (NC516_06975) - 1380481..1381212 (-) 732 WP_011375002.1 YebC/PmpR family DNA-binding transcriptional regulator -
  NC516_RS06980 (NC516_06980) - 1381303..1381803 (-) 501 WP_016265379.1 VanZ family protein -
  NC516_RS06985 (NC516_06985) - 1381900..1382274 (+) 375 WP_011375004.1 hypothetical protein -

Sequence


Protein


Download         Length: 101 a.a.        Molecular weight: 11439.42 Da        Isoelectric Point: 11.1577

>NTDB_id=699976 NC516_RS06945 WP_016265375.1 1377463..1377768(-) (comGE) [Latilactobacillus sakei strain WiKim0095]
MFRSRPAFSLVENIIALTLVLGACWLLTVSLLHFKQQQTLKQQQVAQQAVLAMAAEQLRAHQTVKKRWQMGRTIYTVTAN
QQKLKITTKAGESVAINWTTD

Nucleotide


Download         Length: 306 bp        

>NTDB_id=699976 NC516_RS06945 WP_016265375.1 1377463..1377768(-) (comGE) [Latilactobacillus sakei strain WiKim0095]
ATGTTCAGAAGTAGGCCGGCTTTTTCACTCGTTGAAAATATCATCGCCTTAACCTTGGTATTAGGGGCTTGCTGGCTATT
AACGGTAAGTCTACTACACTTTAAGCAACAACAAACGCTTAAACAACAGCAAGTTGCACAACAGGCGGTTCTAGCAATGG
CCGCTGAGCAGTTGAGAGCGCATCAGACAGTGAAAAAACGCTGGCAAATGGGGCGAACAATCTATACGGTGACGGCTAAT
CAGCAGAAATTAAAGATAACCACAAAGGCAGGTGAGTCGGTTGCGATTAATTGGACGACCGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Latilactobacillus sakei subsp. sakei 23K

99.01

100

0.99