NTDB

Overview

Name	comGF	Type	Machinery gene
Locus tag	NC516_RS06940	Genome accession	NZ_CP099485
Coordinates	1376976..1377488 (-)	Length	170 a.a.
NCBI ID	WP_035145013.1	Uniprot ID	A0A9N7J0G1
Organism	Latilactobacillus sakei strain WiKim0095
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1371976..1382488

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NC516_RS06910 (NC516_06910)	-	1372902..1373267 (+)	366	WP_011374991.1	DUF805 domain-containing protein	-
NC516_RS06920 (NC516_06920)	-	1373810..1374268 (-)	459	WP_035145008.1	hypothetical protein	-
NC516_RS06925 (NC516_06925)	-	1374323..1375519 (-)	1197	WP_011374993.1	acetate kinase	-
NC516_RS06930 (NC516_06930)	-	1375541..1376551 (-)	1011	WP_016265372.1	class I SAM-dependent methyltransferase	-
NC516_RS06935 (NC516_06935)	-	1376675..1377013 (-)	339	WP_035145011.1	hypothetical protein	-
NC516_RS06940 (NC516_06940)	comGF	1376976..1377488 (-)	513	WP_035145013.1	competence type IV pilus minor pilin ComGF	Machinery gene
NC516_RS06945 (NC516_06945)	comGE	1377463..1377768 (-)	306	WP_016265375.1	hypothetical protein	Machinery gene
NC516_RS06950 (NC516_06950)	comGD	1377755..1378207 (-)	453	WP_105300046.1	competence type IV pilus minor pilin ComGD	Machinery gene
NC516_RS06955 (NC516_06955)	comGC	1378179..1378478 (-)	300	WP_025016383.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
NC516_RS06960 (NC516_06960)	comGB	1378475..1379134 (-)	660	WP_252814889.1	type II secretion system F family protein	Machinery gene
NC516_RS06965 (NC516_06965)	comGB	1379152..1379481 (-)	330	WP_252814890.1	type II secretion system F family protein	Machinery gene
NC516_RS06970 (NC516_06970)	comGA	1379474..1380364 (-)	891	WP_025016380.1	competence type IV pilus ATPase ComGA	Machinery gene
NC516_RS06975 (NC516_06975)	-	1380481..1381212 (-)	732	WP_011375002.1	YebC/PmpR family DNA-binding transcriptional regulator	-
NC516_RS06980 (NC516_06980)	-	1381303..1381803 (-)	501	WP_016265379.1	VanZ family protein	-
NC516_RS06985 (NC516_06985)	-	1381900..1382274 (+)	375	WP_011375004.1	hypothetical protein	-

Sequence

Protein

Download Length: 170 a.a. Molecular weight: 19689.58 Da Isoelectric Point: 6.9899

                                >NTDB_id=699975 NC516_RS06940 WP_035145013.1 1376976..1377488(-) (comGF) [Latilactobacillus sakei strain WiKim0095]

MRLIGRPIKHSAFTLIEMVISMAILILTSQLLVATVGVLQKAIKVTQQQQNTINWHISTIQLDQFLADAYFTHHQDQDGS

KITFRKPDTNQSGEEAETVYYLKRMKNEMVVVSQLNGYMPLLGNLKQLQLDYQRPFVQIDATFTDQSRYQHEVFLEEQDE

QAKKKTIKTD

Nucleotide

Download Length: 513 bp

                                >NTDB_id=699975 NC516_RS06940 WP_035145013.1 1376976..1377488(-) (comGF) [Latilactobacillus sakei strain WiKim0095]

TTGCGATTAATTGGACGACCGATTAAGCATTCAGCGTTCACGCTAATTGAAATGGTGATTTCAATGGCGATTCTAATCCT

GACGAGTCAGTTACTGGTGGCAACGGTGGGTGTTTTACAAAAGGCAATTAAAGTCACGCAACAACAGCAAAATACAATCA

ATTGGCATATCAGTACGATTCAGTTAGATCAGTTTTTAGCCGATGCGTATTTTACACATCATCAGGATCAAGATGGCTCC

AAAATCACTTTTCGAAAACCAGACACTAATCAGTCAGGGGAGGAAGCGGAGACTGTTTACTATTTAAAAAGGATGAAAAA

TGAAATGGTTGTTGTCAGCCAATTAAATGGGTATATGCCATTATTAGGCAACCTCAAGCAACTTCAACTTGACTACCAGC

GACCGTTTGTTCAAATCGATGCGACTTTTACGGATCAGAGTCGCTACCAACACGAAGTTTTCTTGGAGGAACAAGATGAA

CAGGCTAAAAAAAAGACGATTAAAACCGATTAA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(40-149)

Prokaryotic N-terminal methylation motif (N_methyl)

(9-25)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGF	Latilactobacillus sakei subsp. sakei 23K	98.235	100	0.982

Detailed information NTG0699975