Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NG745_RS15020 Genome accession   NZ_CP099465
Coordinates   3037081..3037221 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain Ag75     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3032081..3042221
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NG745_RS14995 (NG745_14995) - 3032395..3032778 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  NG745_RS15000 (NG745_15000) comA 3032800..3033444 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  NG745_RS15005 (NG745_15005) comP 3033525..3035876 (-) 2352 WP_269775631.1 histidine kinase Regulator
  NG745_RS15010 (NG745_15010) comX 3035854..3036024 (-) 171 WP_015418105.1 competence pheromone ComX -
  NG745_RS15015 (NG745_15015) - 3036021..3036950 (-) 930 WP_231945405.1 polyprenyl synthetase family protein -
  NG745_RS15020 (NG745_15020) degQ 3037081..3037221 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  NG745_RS15025 (NG745_15025) - 3037686..3038027 (+) 342 WP_007408677.1 hypothetical protein -
  NG745_RS15030 (NG745_15030) - 3038034..3039257 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  NG745_RS15035 (NG745_15035) - 3039387..3040853 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  NG745_RS15040 (NG745_15040) - 3040871..3041422 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  NG745_RS15045 (NG745_15045) - 3041519..3041917 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=699897 NG745_RS15020 WP_003152043.1 3037081..3037221(-) (degQ) [Bacillus velezensis strain Ag75]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=699897 NG745_RS15020 WP_003152043.1 3037081..3037221(-) (degQ) [Bacillus velezensis strain Ag75]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891