Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   NDO76_RS08785 Genome accession   NZ_CP098743
Coordinates   1809456..1809983 (-) Length   175 a.a.
NCBI ID   WP_010776361.1    Uniprot ID   -
Organism   Enterococcus faecalis strain M9     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1775587..1819711 1809456..1809983 within 0


Gene organization within MGE regions


Location: 1775587..1819711
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NDO76_RS08545 (NDO76_08545) - 1775587..1776030 (+) 444 WP_002356885.1 flavodoxin -
  NDO76_RS08550 (NDO76_08550) - 1776105..1776578 (-) 474 WP_002384294.1 TspO/MBR family protein -
  NDO76_RS08555 (NDO76_08555) - 1776736..1777308 (-) 573 WP_002356883.1 TetR/AcrR family transcriptional regulator -
  NDO76_RS08560 (NDO76_08560) - 1777559..1778797 (+) 1239 WP_002362125.1 aminopeptidase -
  NDO76_RS08565 (NDO76_08565) - 1779126..1779374 (+) 249 WP_002404980.1 hypothetical protein -
  NDO76_RS08570 (NDO76_08570) - 1779470..1780432 (-) 963 WP_002404979.1 Abi family protein -
  NDO76_RS08580 (NDO76_08580) - 1780734..1781123 (+) 390 WP_002404978.1 hypothetical protein -
  NDO76_RS08585 (NDO76_08585) - 1781135..1781731 (+) 597 WP_002404977.1 hypothetical protein -
  NDO76_RS08590 (NDO76_08590) - 1781833..1783092 (-) 1260 WP_002404976.1 LysM peptidoglycan-binding domain-containing protein -
  NDO76_RS08595 (NDO76_08595) - 1783097..1783300 (-) 204 WP_002369080.1 phage holin -
  NDO76_RS08600 (NDO76_08600) - 1783297..1783524 (-) 228 WP_002381665.1 hypothetical protein -
  NDO76_RS08605 (NDO76_08605) - 1783616..1786000 (-) 2385 WP_236922054.1 glycerophosphodiester phosphodiesterase family protein -
  NDO76_RS08610 (NDO76_08610) - 1786012..1786185 (-) 174 WP_002404974.1 hypothetical protein -
  NDO76_RS08615 (NDO76_08615) - 1786186..1788204 (-) 2019 WP_002404973.1 phage tail protein -
  NDO76_RS08620 (NDO76_08620) - 1788221..1789150 (-) 930 WP_002373078.1 distal tail protein Dit -
  NDO76_RS08625 (NDO76_08625) - 1789151..1792558 (-) 3408 WP_010776350.1 tape measure protein -
  NDO76_RS08630 (NDO76_08630) - 1792574..1792831 (-) 258 WP_002404971.1 hypothetical protein -
  NDO76_RS08635 (NDO76_08635) - 1792924..1793274 (-) 351 WP_002404970.1 tail assembly chaperone -
  NDO76_RS08640 (NDO76_08640) - 1793330..1793788 (-) 459 WP_002404969.1 hypothetical protein -
  NDO76_RS08645 (NDO76_08645) - 1793866..1794396 (-) 531 WP_002404968.1 phage major tail protein, TP901-1 family -
  NDO76_RS08650 (NDO76_08650) - 1794412..1794801 (-) 390 WP_002404967.1 hypothetical protein -
  NDO76_RS08655 (NDO76_08655) - 1794798..1795178 (-) 381 WP_002402384.1 HK97-gp10 family putative phage morphogenesis protein -
  NDO76_RS08660 (NDO76_08660) - 1795153..1795488 (-) 336 WP_002404966.1 hypothetical protein -
  NDO76_RS08665 (NDO76_08665) - 1795485..1795817 (-) 333 WP_002404965.1 phage head-tail connector protein -
  NDO76_RS08670 (NDO76_08670) - 1795891..1796823 (-) 933 WP_002404964.1 phage major capsid protein -
  NDO76_RS08675 (NDO76_08675) - 1796836..1797435 (-) 600 WP_002404963.1 DUF4355 domain-containing protein -
  NDO76_RS08680 (NDO76_08680) - 1797558..1797821 (-) 264 WP_025188184.1 DUF6275 family protein -
  NDO76_RS08685 (NDO76_08685) - 1797916..1798185 (-) 270 WP_002404961.1 hypothetical protein -
  NDO76_RS08690 (NDO76_08690) - 1798186..1799124 (-) 939 WP_002404960.1 minor capsid protein -
  NDO76_RS08695 (NDO76_08695) - 1799129..1800667 (-) 1539 WP_002404959.1 phage portal protein -
  NDO76_RS08700 (NDO76_08700) - 1800685..1802004 (-) 1320 WP_002404958.1 PBSX family phage terminase large subunit -
  NDO76_RS08705 (NDO76_08705) terS 1801976..1802770 (-) 795 WP_002404957.1 phage terminase small subunit -
  NDO76_RS08710 (NDO76_08710) - 1802823..1803047 (-) 225 WP_002404955.1 hypothetical protein -
  NDO76_RS08720 (NDO76_08720) - 1804628..1805044 (-) 417 WP_002357362.1 ArpU family phage packaging/lysis transcriptional regulator -
  NDO76_RS08725 (NDO76_08725) - 1805467..1805637 (-) 171 WP_010776353.1 hypothetical protein -
  NDO76_RS08730 (NDO76_08730) - 1805637..1805798 (-) 162 WP_164978496.1 hypothetical protein -
  NDO76_RS08735 (NDO76_08735) - 1805799..1806290 (-) 492 WP_078122593.1 DUF1642 domain-containing protein -
  NDO76_RS08740 (NDO76_08740) - 1806293..1806532 (-) 240 WP_074653948.1 hypothetical protein -
  NDO76_RS08745 (NDO76_08745) - 1806544..1806795 (-) 252 WP_078122594.1 hypothetical protein -
  NDO76_RS08750 (NDO76_08750) - 1806792..1807115 (-) 324 WP_089201922.1 DNA-directed RNA polymerase subunit delta -
  NDO76_RS08755 (NDO76_08755) - 1807121..1807357 (-) 237 WP_078122596.1 hypothetical protein -
  NDO76_RS08760 (NDO76_08760) - 1807372..1807596 (-) 225 WP_078122597.1 hypothetical protein -
  NDO76_RS08765 (NDO76_08765) - 1807596..1807943 (-) 348 WP_164978499.1 hypothetical protein -
  NDO76_RS08770 (NDO76_08770) - 1808353..1808835 (-) 483 WP_078122598.1 class I SAM-dependent methyltransferase -
  NDO76_RS08775 (NDO76_08775) - 1808889..1809095 (-) 207 WP_025190349.1 hypothetical protein -
  NDO76_RS08780 (NDO76_08780) - 1809115..1809444 (-) 330 WP_078122599.1 hypothetical protein -
  NDO76_RS08785 (NDO76_08785) ssb 1809456..1809983 (-) 528 WP_010776361.1 single-stranded DNA-binding protein Machinery gene
  NDO76_RS08790 (NDO76_08790) - 1809973..1810281 (-) 309 WP_002381633.1 MazG-like family protein -
  NDO76_RS08795 (NDO76_08795) - 1810281..1811294 (-) 1014 WP_048670087.1 hypothetical protein -
  NDO76_RS08800 (NDO76_08800) - 1811313..1811993 (-) 681 WP_002404926.1 putative HNHc nuclease -
  NDO76_RS08805 (NDO76_08805) - 1811990..1812928 (-) 939 WP_002404925.1 DUF1351 domain-containing protein -
  NDO76_RS08810 (NDO76_08810) - 1812913..1813590 (-) 678 WP_002404924.1 ERF family protein -
  NDO76_RS08815 (NDO76_08815) - 1813591..1813827 (-) 237 WP_002389004.1 hypothetical protein -
  NDO76_RS08820 (NDO76_08820) - 1813884..1814039 (-) 156 WP_002395694.1 hypothetical protein -
  NDO76_RS08825 (NDO76_08825) - 1814147..1814320 (-) 174 WP_002404922.1 hypothetical protein -
  NDO76_RS08830 (NDO76_08830) - 1814342..1814590 (-) 249 WP_002389279.1 hypothetical protein -
  NDO76_RS08835 (NDO76_08835) - 1814606..1815325 (-) 720 WP_002404920.1 phage antirepressor KilAC domain-containing protein -
  NDO76_RS08840 (NDO76_08840) - 1815407..1815640 (-) 234 WP_002389146.1 DUF739 family protein -
  NDO76_RS08845 (NDO76_08845) - 1815799..1816371 (+) 573 WP_002404919.1 helix-turn-helix domain-containing protein -
  NDO76_RS08850 (NDO76_08850) - 1816346..1816861 (+) 516 WP_002404918.1 ImmA/IrrE family metallo-endopeptidase -
  NDO76_RS08855 (NDO76_08855) - 1816950..1817651 (+) 702 WP_002404917.1 DUF5067 domain-containing protein -
  NDO76_RS08860 (NDO76_08860) - 1817675..1817875 (+) 201 WP_002389192.1 hypothetical protein -
  NDO76_RS08865 (NDO76_08865) - 1817936..1818508 (+) 573 WP_010776364.1 hypothetical protein -
  NDO76_RS08870 (NDO76_08870) - 1818575..1819711 (+) 1137 WP_002405155.1 site-specific integrase -

Sequence


Protein


Download         Length: 175 a.a.        Molecular weight: 19345.20 Da        Isoelectric Point: 4.7078

>NTDB_id=697647 NDO76_RS08785 WP_010776361.1 1809456..1809983(-) (ssb) [Enterococcus faecalis strain M9]
MINNVVLIGRLTKDIDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLESKSTNENRNSVQSSQNSVTGVQNNFESNYATNQNKGLNQQNNSQQMSFGGDVDPFA
GAGNSIDISDDDLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=697647 NDO76_RS08785 WP_010776361.1 1809456..1809983(-) (ssb) [Enterococcus faecalis strain M9]
ATGATAAATAATGTGGTATTAATCGGAAGGCTGACGAAAGATATAGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGCAAAGGAACATTATTAGGAGTTGTTGGAAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTGTATGTGACTGAAGTTGTTTGCGAAAGCTTCCAATTATTAGAGTCAAAAAG
CACCAATGAGAATAGAAATAGCGTTCAGAGTTCGCAGAATAGCGTTACAGGCGTTCAAAATAATTTCGAGAGTAATTATG
CCACGAATCAAAACAAAGGCTTAAATCAGCAAAATAACAGCCAACAAATGTCGTTTGGTGGAGATGTAGATCCGTTCGCA
GGTGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCTTTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

59.551

100

0.606

  ssbA Bacillus subtilis subsp. subtilis str. 168

57.865

100

0.589