Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   NDR85_RS12635 Genome accession   NZ_CP098738
Coordinates   2524133..2524480 (-) Length   115 a.a.
NCBI ID   WP_044154580.1    Uniprot ID   -
Organism   Bacillus halotolerans strain XE48     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2519133..2529480
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NDR85_RS12590 (NDR85_12565) sinI 2519660..2519833 (+) 174 WP_024122036.1 anti-repressor SinI Regulator
  NDR85_RS12595 (NDR85_12570) sinR 2519867..2520202 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NDR85_RS12600 (NDR85_12575) tasA 2520288..2521073 (-) 786 WP_044154586.1 biofilm matrix protein TasA -
  NDR85_RS12605 (NDR85_12580) sipW 2521138..2521722 (-) 585 WP_044154585.1 signal peptidase I SipW -
  NDR85_RS12610 (NDR85_12585) tapA 2521694..2522455 (-) 762 WP_044154584.1 amyloid fiber anchoring/assembly protein TapA -
  NDR85_RS12615 (NDR85_12590) - 2522732..2523055 (+) 324 WP_024122040.1 YqzG/YhdC family protein -
  NDR85_RS12620 (NDR85_12595) - 2523098..2523277 (-) 180 WP_003236949.1 YqzE family protein -
  NDR85_RS12625 (NDR85_12600) comGG 2523349..2523723 (-) 375 WP_044154582.1 competence type IV pilus minor pilin ComGG Machinery gene
  NDR85_RS12630 (NDR85_12605) comGF 2523724..2524107 (-) 384 WP_227533974.1 competence type IV pilus minor pilin ComGF Machinery gene
  NDR85_RS12635 (NDR85_12610) comGE 2524133..2524480 (-) 348 WP_044154580.1 competence type IV pilus minor pilin ComGE Machinery gene
  NDR85_RS12640 (NDR85_12615) comGD 2524464..2524895 (-) 432 WP_044154579.1 competence type IV pilus minor pilin ComGD Machinery gene
  NDR85_RS12645 (NDR85_12620) comGC 2524885..2525181 (-) 297 WP_044154578.1 competence type IV pilus major pilin ComGC Machinery gene
  NDR85_RS12650 (NDR85_12625) comGB 2525195..2526232 (-) 1038 WP_044154577.1 competence type IV pilus assembly protein ComGB Machinery gene
  NDR85_RS12655 (NDR85_12630) comGA 2526219..2527289 (-) 1071 WP_024122047.1 competence protein ComGA Machinery gene
  NDR85_RS12660 (NDR85_12635) - 2527610..2528020 (-) 411 WP_024122048.1 CBS domain-containing protein -
  NDR85_RS12665 (NDR85_12640) corA 2528083..2529036 (-) 954 WP_044154576.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 115 a.a.        Molecular weight: 13206.04 Da        Isoelectric Point: 4.4620

>NTDB_id=697556 NDR85_RS12635 WP_044154580.1 2524133..2524480(-) (comGE) [Bacillus halotolerans strain XE48]
MWRENKGFSTIETMAALSIWLFMLLTIVPLWNKLIADEHIAESREIGYQLVNESIGKYMLTGAGNSSQTVSMNNSKYSMT
WEEEGEYQNVCISSDAYKDKPFCLSILRTDWLYAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=697556 NDR85_RS12635 WP_044154580.1 2524133..2524480(-) (comGE) [Bacillus halotolerans strain XE48]
ATGTGGAGAGAAAATAAAGGCTTTTCTACAATTGAAACAATGGCTGCCCTCAGCATATGGCTGTTTATGCTTCTGACGAT
CGTGCCGTTGTGGAACAAGCTGATAGCTGATGAACATATAGCGGAGTCGAGAGAAATTGGTTATCAGCTTGTTAATGAAA
GCATAGGCAAATATATGCTGACAGGAGCAGGAAATTCGTCACAAACTGTTTCGATGAACAATAGCAAATACTCGATGACA
TGGGAGGAGGAGGGAGAGTATCAAAACGTATGCATCTCATCAGACGCCTATAAAGACAAGCCATTTTGCCTCAGCATTTT
GCGGACAGACTGGCTATACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

71.304

100

0.713