Detailed information
Overview
| Name | pilK | Type | Machinery gene |
| Locus tag | NC847_RS02360 | Genome accession | NZ_CP098474 |
| Coordinates | 454236..454844 (+) | Length | 202 a.a. |
| NCBI ID | WP_215318018.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain 10239 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 450276..500346 | 454236..454844 | within | 0 |
Gene organization within MGE regions
Location: 450276..500346
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NC847_RS02340 (NC847_02325) | dnaB | 450276..451682 (+) | 1407 | WP_241532347.1 | replicative DNA helicase | - |
| NC847_RS02345 (NC847_02330) | pilH | 451990..452655 (+) | 666 | WP_263055817.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| NC847_RS02350 (NC847_02335) | pilI | 452684..453292 (+) | 609 | WP_263852580.1 | type IV pilus modification protein PilV | Machinery gene |
| NC847_RS02355 (NC847_02340) | pilJ | 453289..454257 (+) | 969 | WP_260236889.1 | PilW family protein | Machinery gene |
| NC847_RS02360 (NC847_02345) | pilK | 454236..454844 (+) | 609 | WP_215318018.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| NC847_RS02365 (NC847_02350) | pilL | 454846..455319 (+) | 474 | WP_263852591.1 | PilX family type IV pilin | Machinery gene |
| NC847_RS02370 (NC847_02355) | - | 455931..456376 (-) | 446 | Protein_461 | AzlC family ABC transporter permease | - |
| NC847_RS02375 (NC847_02360) | dut | 456542..456994 (+) | 453 | WP_260236890.1 | dUTP diphosphatase | - |
| NC847_RS02380 (NC847_02365) | dapC | 457072..458259 (+) | 1188 | WP_260236891.1 | succinyldiaminopimelate transaminase | - |
| NC847_RS02385 (NC847_02370) | yaaA | 458570..459349 (+) | 780 | WP_260236892.1 | peroxide stress protein YaaA | - |
| NC847_RS02400 (NC847_02385) | - | 459880..461072 (+) | 1193 | Protein_465 | tyrosine-type recombinase/integrase | - |
| NC847_RS02405 (NC847_02390) | - | 461427..461696 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| NC847_RS02410 (NC847_02395) | - | 461891..462574 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| NC847_RS11830 | - | 462855..463121 (-) | 267 | Protein_468 | hypothetical protein | - |
| NC847_RS02420 (NC847_02405) | - | 463232..463447 (-) | 216 | WP_003693860.1 | hypothetical protein | - |
| NC847_RS02425 (NC847_02410) | - | 463499..463990 (-) | 492 | WP_263074863.1 | siphovirus Gp157 family protein | - |
| NC847_RS02430 (NC847_02415) | - | 463987..464169 (-) | 183 | WP_260236894.1 | hypothetical protein | - |
| NC847_RS02435 (NC847_02420) | - | 464309..464995 (-) | 687 | WP_263055815.1 | phage replication initiation protein, NGO0469 family | - |
| NC847_RS02440 (NC847_02425) | - | 465064..465225 (-) | 162 | WP_047924242.1 | hypothetical protein | - |
| NC847_RS02445 (NC847_02430) | - | 465222..465497 (-) | 276 | WP_003695501.1 | NGO1622 family putative holin | - |
| NC847_RS02450 (NC847_02435) | - | 465650..465982 (-) | 333 | WP_003687946.1 | hypothetical protein | - |
| NC847_RS02455 (NC847_02440) | - | 466121..466315 (-) | 195 | WP_003703103.1 | hypothetical protein | - |
| NC847_RS02460 (NC847_02445) | - | 466798..467016 (+) | 219 | WP_003691731.1 | hypothetical protein | - |
| NC847_RS02465 (NC847_02450) | - | 467033..467392 (-) | 360 | WP_003691733.1 | hypothetical protein | - |
| NC847_RS02470 (NC847_02455) | - | 467393..467932 (-) | 540 | WP_003695998.1 | Panacea domain-containing protein | - |
| NC847_RS02475 (NC847_02460) | - | 468092..468808 (-) | 717 | WP_003695999.1 | helix-turn-helix transcriptional regulator | - |
| NC847_RS02480 (NC847_02465) | - | 469189..469416 (+) | 228 | WP_050158909.1 | helix-turn-helix domain-containing protein | - |
| NC847_RS02485 (NC847_02470) | - | 469413..469550 (+) | 138 | WP_010359998.1 | hypothetical protein | - |
| NC847_RS02490 (NC847_02475) | - | 469534..470532 (+) | 999 | WP_263852582.1 | hypothetical protein | - |
| NC847_RS02495 (NC847_02480) | - | 470529..471890 (+) | 1362 | WP_260236895.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| NC847_RS02500 (NC847_02485) | - | 471907..472152 (+) | 246 | WP_260236896.1 | hypothetical protein | - |
| NC847_RS02505 (NC847_02490) | - | 472227..472721 (+) | 495 | WP_260236897.1 | DUF3310 domain-containing protein | - |
| NC847_RS02510 (NC847_02495) | - | 472919..473068 (+) | 150 | WP_003692854.1 | hypothetical protein | - |
| NC847_RS02515 (NC847_02500) | - | 473097..473378 (+) | 282 | WP_229691900.1 | hypothetical protein | - |
| NC847_RS02520 (NC847_02505) | - | 473369..473803 (+) | 435 | WP_260245439.1 | RusA family crossover junction endodeoxyribonuclease | - |
| NC847_RS02525 (NC847_02510) | - | 473796..474101 (+) | 306 | WP_053015205.1 | DUF1364 domain-containing protein | - |
| NC847_RS02530 (NC847_02515) | - | 474098..474481 (+) | 384 | WP_003687982.1 | recombination protein NinB | - |
| NC847_RS02535 (NC847_02520) | - | 474472..474990 (+) | 519 | WP_003687984.1 | HNH endonuclease | - |
| NC847_RS02540 (NC847_02525) | - | 475055..475477 (+) | 423 | WP_003690919.1 | hypothetical protein | - |
| NC847_RS02545 (NC847_02530) | - | 475477..476016 (+) | 540 | WP_003693457.1 | hypothetical protein | - |
| NC847_RS02550 (NC847_02535) | - | 475997..477271 (+) | 1275 | WP_311201960.1 | PBSX family phage terminase large subunit | - |
| NC847_RS02555 (NC847_02540) | - | 477256..479523 (+) | 2268 | WP_225577699.1 | hypothetical protein | - |
| NC847_RS02560 (NC847_02545) | - | 479763..480287 (+) | 525 | WP_260236900.1 | hypothetical protein | - |
| NC847_RS02565 (NC847_02550) | - | 480284..480958 (+) | 675 | WP_260236901.1 | hypothetical protein | - |
| NC847_RS02570 (NC847_02555) | - | 480955..488721 (+) | 7767 | WP_263055812.1 | PLxRFG domain-containing protein | - |
| NC847_RS02575 (NC847_02560) | - | 488819..489226 (+) | 408 | WP_082298808.1 | hypothetical protein | - |
| NC847_RS02580 (NC847_02565) | - | 489237..489662 (+) | 426 | WP_106336882.1 | hypothetical protein | - |
| NC847_RS02585 (NC847_02570) | - | 489655..490542 (+) | 888 | WP_082298758.1 | hypothetical protein | - |
| NC847_RS02590 (NC847_02575) | - | 490542..490922 (+) | 381 | WP_082298757.1 | hypothetical protein | - |
| NC847_RS02595 (NC847_02580) | - | 490925..492694 (+) | 1770 | WP_263852583.1 | hypothetical protein | - |
| NC847_RS02600 (NC847_02585) | - | 492734..494131 (+) | 1398 | WP_263852584.1 | hypothetical protein | - |
| NC847_RS02605 (NC847_02590) | - | 494119..495312 (+) | 1194 | WP_134921505.1 | hypothetical protein | - |
| NC847_RS02610 (NC847_02595) | - | 495397..496296 (+) | 900 | WP_260236904.1 | hypothetical protein | - |
| NC847_RS02620 (NC847_02605) | - | 496317..497612 (+) | 1296 | Protein_508 | DUF4043 family protein | - |
| NC847_RS02625 (NC847_02610) | - | 497671..498144 (+) | 474 | WP_003693439.1 | hypothetical protein | - |
| NC847_RS02630 (NC847_02615) | - | 498150..498635 (+) | 486 | WP_003693438.1 | hypothetical protein | - |
| NC847_RS02635 (NC847_02620) | - | 498632..499306 (+) | 675 | WP_003693436.1 | hypothetical protein | - |
| NC847_RS02640 (NC847_02625) | - | 499309..499458 (+) | 150 | WP_017146863.1 | hypothetical protein | - |
| NC847_RS02645 (NC847_02630) | - | 499495..500346 (-) | 852 | WP_106336892.1 | Bro-N domain-containing protein | - |
Sequence
Protein
Download Length: 202 a.a. Molecular weight: 21884.77 Da Isoelectric Point: 8.4516
>NTDB_id=696022 NC847_RS02360 WP_215318018.1 454236..454844(+) (pilK) [Neisseria gonorrhoeae strain 10239]
MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYTA
DSKVTFSENCGKGLCTAVNVRTNNANEESFGNIVVQSTPTVEAVKRSCPAKSGKNSTGLCIDNQGVEYKKGTASVSKMPR
YIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ
MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYTA
DSKVTFSENCGKGLCTAVNVRTNNANEESFGNIVVQSTPTVEAVKRSCPAKSGKNSTGLCIDNQGVEYKKGTASVSKMPR
YIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ
Nucleotide
Download Length: 609 bp
>NTDB_id=696022 NC847_RS02360 WP_215318018.1 454236..454844(+) (pilK) [Neisseria gonorrhoeae strain 10239]
ATGCGCAAACAGAACACTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTCCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGAGGGAAGGCGAATTTCAGGTTTTGGATTTGGAATATACTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGGAAAAGGCCTGTGTACCGCAGTGAATGTACGGACAAATAATGCTAATGA
AGAGTCTTTTGGCAATATCGTGGTGCAAAGCACGCCCACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTGGCA
AAAATTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATAAGAAAGGCACGGCAAGCGTCAGCAAAATGCCGCGC
TATATTATCGAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGCCAA
TACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA
ATGCGCAAACAGAACACTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTCCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGAGGGAAGGCGAATTTCAGGTTTTGGATTTGGAATATACTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGGAAAAGGCCTGTGTACCGCAGTGAATGTACGGACAAATAATGCTAATGA
AGAGTCTTTTGGCAATATCGTGGTGCAAAGCACGCCCACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTGGCA
AAAATTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATAAGAAAGGCACGGCAAGCGTCAGCAAAATGCCGCGC
TATATTATCGAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGCCAA
TACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilK | Neisseria gonorrhoeae MS11 |
94.581 |
100 |
0.95 |