Detailed information    

insolico Bioinformatically predicted

Overview

Name   cytR   Type   Regulator
Locus tag   M8C01_RS01110 Genome accession   NZ_CP097858
Coordinates   246782..247789 (-) Length   335 a.a.
NCBI ID   WP_009707836.1    Uniprot ID   A0AAP9GE11
Organism   Vibrio owensii strain GL-605     
Function   promote competence gene expression (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 248768..314904 246782..247789 flank 979


Gene organization within MGE regions


Location: 246782..314904
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8C01_RS01110 cytR 246782..247789 (-) 1008 WP_009707836.1 DNA-binding transcriptional regulator CytR Regulator
  M8C01_RS01115 priA 247996..250197 (-) 2202 WP_264404154.1 primosomal protein N' -
  M8C01_RS01120 rpmE 250493..250714 (+) 222 WP_005435070.1 50S ribosomal protein L31 -
  M8C01_RS01125 rpsJ 251170..251481 (+) 312 WP_004410492.1 30S ribosomal protein S10 -
  M8C01_RS01130 rplC 251496..252125 (+) 630 WP_005435072.1 50S ribosomal protein L3 -
  M8C01_RS01135 rplD 252143..252745 (+) 603 WP_005435074.1 50S ribosomal protein L4 -
  M8C01_RS01140 rplW 252742..253044 (+) 303 WP_004398471.1 50S ribosomal protein L23 -
  M8C01_RS01145 rplB 253060..253884 (+) 825 WP_005435076.1 50S ribosomal protein L2 -
  M8C01_RS01150 rpsS 253906..254184 (+) 279 WP_005435078.1 30S ribosomal protein S19 -
  M8C01_RS01155 rplV 254195..254527 (+) 333 WP_005383164.1 50S ribosomal protein L22 -
  M8C01_RS01160 rpsC 254546..255244 (+) 699 WP_005435080.1 30S ribosomal protein S3 -
  M8C01_RS01165 rplP 255256..255666 (+) 411 WP_005379577.1 50S ribosomal protein L16 -
  M8C01_RS01170 rpmC 255666..255857 (+) 192 WP_004410456.1 50S ribosomal protein L29 -
  M8C01_RS01175 rpsQ 255857..256111 (+) 255 WP_005435082.1 30S ribosomal protein S17 -
  M8C01_RS01180 rplN 256276..256647 (+) 372 WP_004410450.1 50S ribosomal protein L14 -
  M8C01_RS01185 rplX 256661..256978 (+) 318 WP_005435084.1 50S ribosomal protein L24 -
  M8C01_RS01190 rplE 257002..257541 (+) 540 WP_004745887.1 50S ribosomal protein L5 -
  M8C01_RS01195 rpsN 257559..257864 (+) 306 WP_004410442.1 30S ribosomal protein S14 -
  M8C01_RS01200 rpsH 257894..258286 (+) 393 WP_009707834.1 30S ribosomal protein S8 -
  M8C01_RS01205 rplF 258299..258832 (+) 534 WP_005435087.1 50S ribosomal protein L6 -
  M8C01_RS01210 rplR 258842..259195 (+) 354 WP_005435088.1 50S ribosomal protein L18 -
  M8C01_RS01215 rpsE 259210..259713 (+) 504 WP_005435090.1 30S ribosomal protein S5 -
  M8C01_RS01220 rpmD 259721..259897 (+) 177 WP_000201159.1 50S ribosomal protein L30 -
  M8C01_RS01225 rplO 259904..260338 (+) 435 WP_005435092.1 50S ribosomal protein L15 -
  M8C01_RS01230 secY 260359..261693 (+) 1335 WP_005435093.1 preprotein translocase subunit SecY -
  M8C01_RS01235 rpmJ 261732..261845 (+) 114 WP_000868186.1 50S ribosomal protein L36 -
  M8C01_RS01240 rpsM 261995..262351 (+) 357 WP_005435100.1 30S ribosomal protein S13 -
  M8C01_RS01245 rpsK 262370..262759 (+) 390 WP_001118870.1 30S ribosomal protein S11 -
  M8C01_RS01250 rpsD 262787..263407 (+) 621 WP_005383146.1 30S ribosomal protein S4 -
  M8C01_RS01255 - 263432..264424 (+) 993 WP_005383143.1 DNA-directed RNA polymerase subunit alpha -
  M8C01_RS01260 rplQ 264451..264831 (+) 381 WP_005383141.1 50S ribosomal protein L17 -
  M8C01_RS01265 - 264990..265469 (-) 480 WP_264404155.1 DUF2780 domain-containing protein -
  M8C01_RS01270 - 265621..266241 (-) 621 WP_005437303.1 FKBP-type peptidyl-prolyl cis-trans isomerase -
  M8C01_RS01275 - 266473..267069 (+) 597 WP_033005517.1 LysM-like peptidoglycan-binding domain-containing protein -
  M8C01_RS01280 - 267132..267992 (-) 861 WP_264404156.1 DMT family transporter -
  M8C01_RS01285 - 267993..268445 (-) 453 WP_039841369.1 GNAT family N-acetyltransferase -
  M8C01_RS01290 dbpA 268592..269971 (+) 1380 WP_264404157.1 ATP-dependent RNA helicase DbpA -
  M8C01_RS01295 - 270032..270379 (-) 348 WP_122068330.1 hypothetical protein -
  M8C01_RS01300 - 270585..271160 (-) 576 WP_054823058.1 Crp/Fnr family transcriptional regulator -
  M8C01_RS01305 cpdB 271258..273219 (-) 1962 WP_264404158.1 2',3'-cyclic-nucleotide 2'-phosphodiesterase -
  M8C01_RS01310 cobA 273495..274370 (+) 876 WP_264404159.1 uroporphyrinogen-III C-methyltransferase -
  M8C01_RS01315 cysD 274430..275338 (+) 909 WP_005430587.1 sulfate adenylyltransferase subunit CysD -
  M8C01_RS01320 cysN 275357..276787 (+) 1431 WP_005528550.1 sulfate adenylyltransferase subunit CysN -
  M8C01_RS01325 - 276998..278722 (+) 1725 WP_264404160.1 SLC13 family permease -
  M8C01_RS01330 cysC 278747..279364 (+) 618 WP_020196529.1 adenylyl-sulfate kinase -
  M8C01_RS01335 - 279455..280360 (-) 906 WP_020196530.1 TIGR03899 family protein -
  M8C01_RS01340 - 280700..281194 (-) 495 WP_009707821.1 DUF3299 domain-containing protein -
  M8C01_RS01345 - 281200..282459 (-) 1260 WP_264404161.1 ABC transporter permease -
  M8C01_RS01350 - 282456..283184 (-) 729 WP_132698559.1 ABC transporter ATP-binding protein -
  M8C01_RS01355 - 283237..283977 (-) 741 WP_264404162.1 DUF2796 domain-containing protein -
  M8C01_RS01360 - 284077..284376 (-) 300 WP_005437348.1 DUF2607 family protein -
  M8C01_RS01365 - 284553..285104 (-) 552 WP_009707817.1 YtfJ family protein -
  M8C01_RS01370 - 285321..285521 (+) 201 WP_009707816.1 DUF1107 domain-containing protein -
  M8C01_RS01375 gmtY 285676..287133 (+) 1458 WP_054823053.1 gamma-mobile-trio recombinase GmtY -
  M8C01_RS01380 - 287133..289796 (+) 2664 WP_054823052.1 integrase family protein -
  M8C01_RS01385 gmtX 289796..290473 (+) 678 WP_054823051.1 gamma-mobile-trio protein GmtX -
  M8C01_RS01390 - 290473..290910 (+) 438 WP_054823050.1 VPA1267 family protein -
  M8C01_RS01395 - 290907..293072 (+) 2166 WP_122045057.1 AAA family ATPase -
  M8C01_RS01400 - 293252..294889 (-) 1638 WP_122045056.1 P-loop NTPase fold protein -
  M8C01_RS01405 - 295462..296901 (+) 1440 WP_122045055.1 SIR2 family protein -
  M8C01_RS01410 - 296905..297351 (+) 447 WP_122045054.1 TIR domain-containing protein -
  M8C01_RS01415 - 297796..298260 (-) 465 WP_122045053.1 hypothetical protein -
  M8C01_RS01420 - 298348..298535 (-) 188 Protein_270 IS3 family transposase -
  M8C01_RS01425 msrA 299740..300378 (-) 639 WP_264404163.1 peptide-methionine (S)-S-oxide reductase MsrA -
  M8C01_RS01430 - 300545..302257 (+) 1713 WP_180825855.1 autotransporter assembly complex family protein -
  M8C01_RS01435 - 302254..306189 (+) 3936 WP_264404164.1 translocation/assembly module TamB domain-containing protein -
  M8C01_RS01440 - 306222..306569 (+) 348 WP_039984654.1 gamma-glutamylcyclotransferase -
  M8C01_RS01445 - 306634..306972 (+) 339 WP_020196538.1 DUF2799 domain-containing protein -
  M8C01_RS01450 - 307003..307362 (+) 360 WP_009707810.1 DUF2799 domain-containing protein -
  M8C01_RS01455 ppa 307428..307958 (-) 531 WP_005437361.1 inorganic diphosphatase -
  M8C01_RS01460 fbp 308084..309100 (-) 1017 WP_005430527.1 class 1 fructose-bisphosphatase -
  M8C01_RS01465 mpl 309414..310772 (+) 1359 WP_264404165.1 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase -
  M8C01_RS01470 - 310772..311410 (+) 639 WP_061065566.1 flavin prenyltransferase UbiX -
  M8C01_RS01475 thiB 311661..312653 (+) 993 WP_264404166.1 thiamine ABC transporter substrate binding subunit -
  M8C01_RS01480 thiP 312668..314254 (+) 1587 WP_264404167.1 thiamine/thiamine pyrophosphate ABC transporter permease ThiP -

Sequence

Protein


Download         Length: 335 a.a.        Molecular weight: 36959.54 Da        Isoelectric Point: 5.9796

>NTDB_id=693097 M8C01_RS01110 WP_009707836.1 246782..247789(-) (cytR) [Vibrio owensii strain GL-605]
MATMKDVAQLAGVSTATVSRALMNPEKVSSSTRKRVEDAVLEAGYSPNSLARNLRRNESKTIVTIVPDICDPYFSEIIRG
IEDAAMEHGYLVLLGDSGQQKKRESSFVNLVFTKQADGMLLLGTDLPFDVSKPEQKNLPPMVMACEFAPELELPTVHIDN
LTSAFEAVNYLTQLGHKRIAQISGPDTAVLCQFRQQGYQQALRRAGINKEEQYSVIADFSFEGGVQAVRKLLELPEPPTA
LFCHCDTMAIGAIQEAKRLGLRIPQDLSIVGFDDIQFAQYCDPPLTTISQPRYEIGRQAMLMMLELLKGHDVHSGSRLLE
TKLVVRGSAAPPPLR

Nucleotide


Download         Length: 1008 bp        

>NTDB_id=693097 M8C01_RS01110 WP_009707836.1 246782..247789(-) (cytR) [Vibrio owensii strain GL-605]
ATGGCGACAATGAAGGATGTTGCCCAGCTTGCGGGGGTATCTACTGCTACGGTATCGCGAGCATTGATGAATCCAGAAAA
AGTCTCTTCATCGACAAGAAAGAGAGTGGAAGATGCCGTACTAGAAGCTGGTTATTCACCGAATTCATTAGCTCGTAACT
TACGCAGAAATGAATCAAAGACCATTGTCACTATCGTCCCAGACATTTGCGACCCGTACTTCTCTGAGATTATTCGCGGC
ATTGAAGACGCAGCAATGGAACACGGTTACCTTGTTCTACTTGGTGATAGCGGTCAGCAGAAAAAGCGTGAAAGCTCATT
TGTAAACTTAGTCTTCACCAAACAAGCTGATGGCATGCTGCTTCTCGGAACCGACCTGCCTTTTGATGTCAGCAAGCCAG
AACAAAAAAACCTACCACCTATGGTGATGGCGTGTGAGTTCGCACCAGAGCTTGAACTGCCAACGGTGCACATCGATAAC
CTCACCTCTGCGTTCGAGGCTGTAAATTACCTGACTCAACTTGGCCATAAGCGAATTGCTCAAATCTCTGGTCCTGACAC
TGCGGTACTTTGTCAGTTCCGCCAACAGGGTTACCAGCAAGCACTTCGTCGCGCAGGCATTAATAAAGAAGAGCAATACA
GCGTGATCGCAGACTTCTCTTTTGAAGGCGGCGTGCAAGCAGTCCGTAAACTTCTTGAGTTACCGGAACCACCAACCGCA
CTCTTCTGCCACTGTGACACCATGGCGATTGGTGCCATTCAAGAAGCGAAACGTCTAGGTTTACGTATTCCTCAAGATTT
ATCGATCGTGGGCTTTGATGACATTCAGTTCGCACAATACTGCGATCCACCGTTAACGACTATCTCCCAACCTCGTTATG
AAATCGGTCGTCAAGCAATGTTAATGATGCTTGAACTATTGAAAGGCCATGACGTTCACTCCGGCTCTCGTTTACTAGAG
ACTAAGTTAGTTGTTCGTGGCAGCGCAGCGCCACCGCCATTGCGTTAA

Domains

Predicted by InterproScan.

Periplasmic binding protein-like domain (Peripla_BP_3)

(168-328)

Bacterial regulatory proteins, lacI family (LacI)

(3-48)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cytR Vibrio parahaemolyticus RIMD 2210633

96.386

99.104

0.955
  cytR Vibrio cholerae C6706

90.361

99.104

0.896