Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   MF619_RS12015 Genome accession   NZ_CP097784
Coordinates   2426268..2426582 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain V 3.14     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2421268..2431582
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MF619_RS11970 (MF619_002387) sinI 2421951..2422124 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  MF619_RS11975 (MF619_002388) sinR 2422158..2422493 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MF619_RS11980 (MF619_002389) tasA 2422541..2423326 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  MF619_RS11985 (MF619_002390) sipW 2423390..2423974 (-) 585 WP_025852917.1 signal peptidase I SipW -
  MF619_RS11990 (MF619_002391) tapA 2423946..2424617 (-) 672 WP_025852919.1 amyloid fiber anchoring/assembly protein TapA -
  MF619_RS11995 (MF619_002392) - 2424876..2425205 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  MF619_RS12000 (MF619_002393) - 2425245..2425424 (-) 180 WP_003153093.1 YqzE family protein -
  MF619_RS12005 (MF619_002394) comGG 2425481..2425858 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  MF619_RS12010 (MF619_002395) comGF 2425859..2426359 (-) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  MF619_RS12015 (MF619_002396) comGE 2426268..2426582 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  MF619_RS12020 (MF619_002397) comGD 2426566..2427003 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  MF619_RS12025 (MF619_002398) comGC 2426993..2427301 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  MF619_RS12030 (MF619_002399) comGB 2427306..2428343 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  MF619_RS12035 (MF619_002400) comGA 2428330..2429400 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  MF619_RS12040 (MF619_002401) - 2429592..2430542 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=692370 MF619_RS12015 WP_015388003.1 2426268..2426582(-) (comGE) [Bacillus velezensis strain V 3.14]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=692370 MF619_RS12015 WP_015388003.1 2426268..2426582(-) (comGE) [Bacillus velezensis strain V 3.14]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGCGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481