Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | MF628_RS26635 | Genome accession | NZ_CP097767 |
| Coordinates | 5730560..5731009 (-) | Length | 149 a.a. |
| NCBI ID | WP_250271684.1 | Uniprot ID | - |
| Organism | Paenibacillus polymyxa strain R 5.31 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 5722293..5757633 | 5730560..5731009 | within | 0 |
Gene organization within MGE regions
Location: 5722293..5757633
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MF628_RS26590 (MF628_005293) | - | 5722419..5722643 (-) | 225 | Protein_5189 | hypothetical protein | - |
| MF628_RS26595 (MF628_005294) | - | 5722707..5722987 (+) | 281 | Protein_5190 | IS1595 family transposase | - |
| MF628_RS26600 (MF628_005295) | - | 5723012..5723408 (-) | 397 | Protein_5191 | VOC family protein | - |
| MF628_RS26605 (MF628_08980) | - | 5723842..5724366 (-) | 525 | WP_250271678.1 | hypothetical protein | - |
| MF628_RS26610 (MF628_005297) | - | 5724750..5725175 (-) | 426 | WP_416383368.1 | hypothetical protein | - |
| MF628_RS26615 (MF628_005298) | - | 5725624..5727043 (-) | 1420 | Protein_5194 | transcriptional regulator | - |
| MF628_RS26620 (MF628_005299) | - | 5727202..5727384 (-) | 183 | WP_250271679.1 | hypothetical protein | - |
| MF628_RS26625 (MF628_005300) | - | 5727758..5727946 (+) | 189 | WP_250271681.1 | hypothetical protein | - |
| MF628_RS26630 (MF628_005301) | - | 5728887..5729957 (-) | 1071 | WP_250271683.1 | hypothetical protein | - |
| MF628_RS26635 (MF628_005302) | nucA/comI | 5730560..5731009 (-) | 450 | WP_250271684.1 | NucA/NucB deoxyribonuclease domain-containing protein | Machinery gene |
| MF628_RS26640 (MF628_005303) | - | 5731148..5731456 (-) | 309 | WP_250271686.1 | DUF2500 family protein | - |
| MF628_RS26645 (MF628_005304) | - | 5732766..5733671 (-) | 906 | WP_250271688.1 | copper amine oxidase N-terminal domain-containing protein | - |
| MF628_RS26650 (MF628_005305) | - | 5733906..5734595 (+) | 690 | WP_250271690.1 | hypothetical protein | - |
| MF628_RS26655 (MF628_005306) | - | 5734808..5735017 (-) | 210 | WP_190297201.1 | hypothetical protein | - |
| MF628_RS26660 (MF628_005307) | - | 5735111..5735226 (-) | 116 | Protein_5203 | 2-pyrone-4,6-dicarboxylate hydrolase | - |
| MF628_RS26665 (MF628_005308) | - | 5735266..5736417 (-) | 1152 | WP_242210790.1 | epoxide hydrolase family protein | - |
| MF628_RS26670 (MF628_08985) | - | 5736525..5737379 (+) | 855 | WP_242210789.1 | helix-turn-helix domain-containing protein | - |
| MF628_RS26675 (MF628_005310) | - | 5737695..5738165 (-) | 471 | WP_250271692.1 | hypothetical protein | - |
| MF628_RS26680 (MF628_08990) | - | 5738938..5740368 (+) | 1431 | WP_250271693.1 | radical SAM/SPASM domain-containing protein | - |
| MF628_RS26685 (MF628_005312) | - | 5740424..5740570 (-) | 147 | WP_250271696.1 | hypothetical protein | - |
| MF628_RS27255 | - | 5740539..5740718 (-) | 180 | WP_416383397.1 | SIS domain-containing protein | - |
| MF628_RS26690 (MF628_08995) | - | 5740956..5741243 (-) | 288 | WP_250271697.1 | helix-turn-helix domain-containing protein | - |
| MF628_RS26695 (MF628_005314) | - | 5741233..5741415 (-) | 183 | WP_060628847.1 | YvrJ family protein | - |
| MF628_RS26700 (MF628_005315) | - | 5741421..5742017 (-) | 597 | WP_250271700.1 | RNA polymerase sigma factor | - |
| MF628_RS26705 (MF628_005316) | - | 5742809..5743669 (-) | 861 | WP_250271702.1 | hypothetical protein | - |
| MF628_RS27260 | - | 5743926..5744186 (-) | 261 | Protein_5214 | MarR family transcriptional regulator | - |
| MF628_RS26710 (MF628_005317) | - | 5744701..5745786 (-) | 1086 | WP_250271704.1 | major royal jelly family protein | - |
| MF628_RS26715 (MF628_005318) | - | 5746341..5746622 (-) | 282 | WP_250271705.1 | hypothetical protein | - |
| MF628_RS26720 (MF628_005319) | - | 5746813..5747055 (+) | 243 | WP_171644152.1 | spore gernimation protein GerQ | - |
| MF628_RS26725 (MF628_005320) | - | 5747068..5747454 (+) | 387 | WP_044785937.1 | spore coat protein | - |
| MF628_RS26730 (MF628_005321) | - | 5747451..5748587 (+) | 1137 | WP_250271708.1 | zinc-dependent alcohol dehydrogenase | - |
| MF628_RS26735 (MF628_005322) | - | 5748619..5748819 (+) | 201 | WP_250271710.1 | hypothetical protein | - |
| MF628_RS26740 (MF628_005323) | - | 5748831..5749127 (+) | 297 | WP_250271712.1 | spore coat protein | - |
| MF628_RS26745 (MF628_005324) | - | 5750313..5751899 (+) | 1587 | WP_250271714.1 | spore germination protein | - |
| MF628_RS26750 (MF628_005325) | - | 5751914..5753101 (+) | 1188 | WP_323873283.1 | Ger(x)C family spore germination protein | - |
| MF628_RS26755 (MF628_005326) | - | 5753098..5753322 (+) | 225 | WP_250238797.1 | hypothetical protein | - |
| MF628_RS26760 (MF628_005327) | - | 5753333..5754445 (+) | 1113 | WP_323873284.1 | GerAB/ArcD/ProY family transporter | - |
| MF628_RS26765 (MF628_005328) | - | 5754942..5755256 (-) | 315 | WP_250271715.1 | DMT family transporter | - |
| MF628_RS26770 (MF628_005329) | - | 5755260..5755601 (-) | 342 | WP_025723001.1 | DMT family transporter | - |
| MF628_RS26775 (MF628_005330) | - | 5755877..5756395 (-) | 519 | WP_250274071.1 | GNAT family N-acetyltransferase | - |
| MF628_RS26780 (MF628_005331) | - | 5756422..5756874 (-) | 453 | WP_076293702.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| MF628_RS26785 (MF628_005332) | - | 5756989..5757633 (+) | 645 | WP_250271716.1 | YczE/YyaS/YitT family protein | - |
Sequence
Protein
Download Length: 149 a.a. Molecular weight: 16292.54 Da Isoelectric Point: 6.4783
>NTDB_id=692120 MF628_RS26635 WP_250271684.1 5730560..5731009(-) (nucA/comI) [Paenibacillus polymyxa strain R 5.31]
MIRWMITLLATVLLAGCSVQQQVEVTPSKTAPVASQVTQVSLETVKLEFPSAKYPETAQHIKEAIAAGHTNTCTIDRDGA
DHNRELSLKDVPTRKGKDRDEWPMAMCAEGGVGADVKYISPKDNRGAGSWVGHKLNEYPDGTKIEFIIN
MIRWMITLLATVLLAGCSVQQQVEVTPSKTAPVASQVTQVSLETVKLEFPSAKYPETAQHIKEAIAAGHTNTCTIDRDGA
DHNRELSLKDVPTRKGKDRDEWPMAMCAEGGVGADVKYISPKDNRGAGSWVGHKLNEYPDGTKIEFIIN
Nucleotide
Download Length: 450 bp
>NTDB_id=692120 MF628_RS26635 WP_250271684.1 5730560..5731009(-) (nucA/comI) [Paenibacillus polymyxa strain R 5.31]
ATGATTAGATGGATGATTACCTTACTGGCTACAGTCCTATTAGCTGGCTGCAGTGTGCAACAACAGGTAGAAGTTACACC
GAGCAAAACAGCGCCTGTTGCTTCACAAGTAACCCAAGTATCATTAGAAACCGTAAAACTTGAGTTTCCCTCAGCAAAGT
ACCCGGAAACAGCACAGCACATCAAGGAGGCCATAGCAGCCGGACACACCAATACATGTACCATTGATCGTGACGGAGCT
GATCATAACCGTGAACTGTCACTTAAAGATGTACCCACGCGCAAGGGCAAAGACCGCGATGAATGGCCAATGGCAATGTG
TGCGGAAGGCGGAGTGGGAGCGGACGTTAAATACATATCACCAAAGGATAACCGTGGGGCTGGATCATGGGTAGGTCACA
AGCTGAATGAATATCCAGACGGCACAAAGATTGAATTTATTATTAATTAG
ATGATTAGATGGATGATTACCTTACTGGCTACAGTCCTATTAGCTGGCTGCAGTGTGCAACAACAGGTAGAAGTTACACC
GAGCAAAACAGCGCCTGTTGCTTCACAAGTAACCCAAGTATCATTAGAAACCGTAAAACTTGAGTTTCCCTCAGCAAAGT
ACCCGGAAACAGCACAGCACATCAAGGAGGCCATAGCAGCCGGACACACCAATACATGTACCATTGATCGTGACGGAGCT
GATCATAACCGTGAACTGTCACTTAAAGATGTACCCACGCGCAAGGGCAAAGACCGCGATGAATGGCCAATGGCAATGTG
TGCGGAAGGCGGAGTGGGAGCGGACGTTAAATACATATCACCAAAGGATAACCGTGGGGCTGGATCATGGGTAGGTCACA
AGCTGAATGAATATCCAGACGGCACAAAGATTGAATTTATTATTAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
71.569 |
68.456 |
0.49 |