Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   M8965_RS09520 Genome accession   NZ_CP097602
Coordinates   1833952..1834071 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain UA0244     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 1828952..1839071
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8965_RS09495 - 1829191..1829949 (-) 759 WP_007609404.1 ABC transporter ATP-binding protein -
  M8965_RS09500 - 1829943..1830890 (-) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  M8965_RS09505 ceuB 1830880..1831833 (-) 954 WP_032872883.1 ABC transporter permease Machinery gene
  M8965_RS09510 - 1832247..1833611 (+) 1365 WP_007609394.1 aspartate kinase -
  M8965_RS09515 - 1833706..1833801 (+) 96 WP_021495118.1 YjcZ family sporulation protein -
  M8965_RS09520 phrC 1833952..1834071 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  M8965_RS09525 rapC 1834055..1835203 (-) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  M8965_RS09530 - 1835356..1836789 (-) 1434 WP_161503657.1 HAMP domain-containing sensor histidine kinase -
  M8965_RS09535 - 1836776..1837459 (-) 684 WP_032872879.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=691010 M8965_RS09520 WP_003156334.1 1833952..1834071(-) (phrC) [Bacillus velezensis strain UA0244]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=691010 M8965_RS09520 WP_003156334.1 1833952..1834071(-) (phrC) [Bacillus velezensis strain UA0244]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGAGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718