Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   M8969_RS02590 Genome accession   NZ_CP097593
Coordinates   545588..545707 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain UA0229     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 540588..550707
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8969_RS02575 - 542200..542883 (+) 684 WP_032872879.1 response regulator transcription factor -
  M8969_RS02580 - 542870..544303 (+) 1434 WP_161503657.1 HAMP domain-containing sensor histidine kinase -
  M8969_RS02585 rapC 544456..545604 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  M8969_RS02590 phrC 545588..545707 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  M8969_RS02595 - 545858..545953 (-) 96 WP_021495118.1 YjcZ family sporulation protein -
  M8969_RS02600 - 546048..547412 (-) 1365 WP_007609394.1 aspartate kinase -
  M8969_RS02605 ceuB 547826..548779 (+) 954 WP_032872883.1 ABC transporter permease Machinery gene
  M8969_RS02610 - 548769..549716 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  M8969_RS02615 - 549710..550468 (+) 759 WP_007609404.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=690832 M8969_RS02590 WP_003156334.1 545588..545707(+) (phrC) [Bacillus velezensis strain UA0229]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=690832 M8969_RS02590 WP_003156334.1 545588..545707(+) (phrC) [Bacillus velezensis strain UA0229]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGAGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718