Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   M8962_RS12650 Genome accession   NZ_CP097591
Coordinates   2598016..2598189 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain UA0188     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2593016..2603189
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8962_RS12600 comGD 2593136..2593573 (+) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  M8962_RS12605 comGE 2593557..2593871 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  M8962_RS12610 comGF 2593780..2594280 (+) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  M8962_RS12615 comGG 2594281..2594658 (+) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  M8962_RS12620 - 2594715..2594894 (+) 180 WP_003153093.1 YqzE family protein -
  M8962_RS12625 - 2594934..2595263 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  M8962_RS12630 tapA 2595522..2596193 (+) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  M8962_RS12635 - 2596165..2596749 (+) 585 WP_012117977.1 signal peptidase I -
  M8962_RS12640 - 2596814..2597599 (+) 786 WP_007408329.1 TasA family protein -
  M8962_RS12645 sinR 2597647..2597982 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M8962_RS12650 sinI 2598016..2598189 (-) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  M8962_RS12655 - 2598366..2599160 (-) 795 WP_012117976.1 YqhG family protein -
  M8962_RS12660 - 2599182..2600852 (-) 1671 WP_012117975.1 SNF2-related protein -
  M8962_RS12665 gcvT 2601276..2602376 (+) 1101 WP_012117974.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=690798 M8962_RS12650 WP_003153105.1 2598016..2598189(-) (sinI) [Bacillus velezensis strain UA0188]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=690798 M8962_RS12650 WP_003153105.1 2598016..2598189(-) (sinI) [Bacillus velezensis strain UA0188]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702