Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   M8957_RS07920 Genome accession   NZ_CP097587
Coordinates   1702988..1703128 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain UA0276     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1697988..1708128
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8957_RS07895 - 1698334..1698717 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  M8957_RS07900 comA 1698739..1699383 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  M8957_RS07905 comP 1699464..1701764 (-) 2301 WP_012118313.1 histidine kinase Regulator
  M8957_RS07910 comX 1701778..1701951 (-) 174 WP_012118314.1 competence pheromone ComX -
  M8957_RS07915 - 1701920..1702780 (-) 861 WP_012118315.1 polyprenyl synthetase family protein -
  M8957_RS07920 degQ 1702988..1703128 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  M8957_RS07925 - 1703593..1703934 (+) 342 WP_012118316.1 hypothetical protein -
  M8957_RS07930 - 1703941..1705164 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  M8957_RS07935 - 1705294..1706760 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  M8957_RS07940 - 1706778..1707329 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  M8957_RS07945 - 1707426..1707824 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=690480 M8957_RS07920 WP_003152043.1 1702988..1703128(-) (degQ) [Bacillus velezensis strain UA0276]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=690480 M8957_RS07920 WP_003152043.1 1702988..1703128(-) (degQ) [Bacillus velezensis strain UA0276]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891