Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | M8964_RS03330 | Genome accession | NZ_CP097585 |
| Coordinates | 646302..646442 (+) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain UA1365 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 641302..651442
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8964_RS03305 | - | 641606..642004 (+) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
| M8964_RS03310 | - | 642101..642652 (+) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| M8964_RS03315 | - | 642670..644136 (+) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| M8964_RS03320 | - | 644266..645489 (+) | 1224 | WP_007408678.1 | EAL and HDOD domain-containing protein | - |
| M8964_RS03325 | - | 645496..645837 (-) | 342 | WP_012118316.1 | hypothetical protein | - |
| M8964_RS03330 | degQ | 646302..646442 (+) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| M8964_RS03335 | - | 646650..647510 (+) | 861 | WP_012118315.1 | polyprenyl synthetase family protein | - |
| M8964_RS03340 | comX | 647479..647652 (+) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| M8964_RS03345 | comP | 647666..649966 (+) | 2301 | WP_012118313.1 | histidine kinase | Regulator |
| M8964_RS03350 | comA | 650047..650691 (+) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| M8964_RS03355 | - | 650713..651096 (+) | 384 | WP_012118312.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=690385 M8964_RS03330 WP_003152043.1 646302..646442(+) (degQ) [Bacillus velezensis strain UA1365]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=690385 M8964_RS03330 WP_003152043.1 646302..646442(+) (degQ) [Bacillus velezensis strain UA1365]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |