Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   OTU47_RS11450 Genome accession   NZ_CP113115
Coordinates   2188331..2188480 (-) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   Q9FBH1
Organism   Streptococcus pneumoniae strain NP2     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 2183331..2193480
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OTU47_RS11415 (OTU47_11415) trmB 2183573..2184208 (-) 636 WP_001266083.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -
  OTU47_RS11420 (OTU47_11420) ccrZ 2184205..2184999 (-) 795 WP_000363002.1 cell cycle regulator CcrZ -
  OTU47_RS11425 (OTU47_11425) - 2185161..2185772 (-) 612 WP_050202405.1 CPBP family intramembrane glutamic endopeptidase -
  OTU47_RS11430 (OTU47_11430) blpZ 2185923..2186156 (-) 234 WP_000276498.1 immunity protein BlpZ -
  OTU47_RS11435 (OTU47_11435) - 2186198..2186887 (-) 690 WP_050233598.1 CPBP family intramembrane glutamic endopeptidase -
  OTU47_RS11440 (OTU47_11440) - 2186939..2187322 (-) 384 WP_000877381.1 hypothetical protein -
  OTU47_RS11445 (OTU47_11445) - 2188108..2188227 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  OTU47_RS11450 (OTU47_11450) cipB 2188331..2188480 (-) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator
  OTU47_RS11455 (OTU47_11455) blpN 2188724..2188927 (-) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  OTU47_RS11460 (OTU47_11460) blpM 2188943..2189197 (-) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  OTU47_RS11465 (OTU47_11465) - 2189347..2190152 (-) 806 Protein_2227 IS5 family transposase -
  OTU47_RS11470 (OTU47_11470) - 2190355..2190759 (-) 405 WP_000846944.1 hypothetical protein -
  OTU47_RS11475 (OTU47_11475) - 2190756..2190920 (-) 165 WP_000727118.1 hypothetical protein -
  OTU47_RS11480 (OTU47_11480) - 2191219..2191338 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  OTU47_RS11485 (OTU47_11485) blpU 2191341..2191571 (-) 231 WP_000379967.1 bacteriocin-like peptide BlpU -
  OTU47_RS11490 (OTU47_11490) blpJ 2191640..2191909 (-) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  OTU47_RS11495 (OTU47_11495) blpI 2192376..2192573 (-) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  OTU47_RS12060 comA/nlmT 2192887..2193474 (+) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=689850 OTU47_RS11450 WP_001818346.1 2188331..2188480(-) (cipB) [Streptococcus pneumoniae strain NP2]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=689850 OTU47_RS11450 WP_001818346.1 2188331..2188480(-) (cipB) [Streptococcus pneumoniae strain NP2]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q9FBH1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51