Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | M5C55_RS12115 | Genome accession | NZ_CP097359 |
| Coordinates | 2497510..2497650 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain H208 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2492510..2502650
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5C55_RS12090 (M5C55_12090) | - | 2492856..2493239 (-) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
| M5C55_RS12095 (M5C55_12095) | comA | 2493261..2493905 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| M5C55_RS12100 (M5C55_12100) | comP | 2493986..2496286 (-) | 2301 | WP_032876801.1 | histidine kinase | Regulator |
| M5C55_RS12105 (M5C55_12105) | comX | 2496300..2496473 (-) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| M5C55_RS12110 (M5C55_12110) | - | 2496442..2497302 (-) | 861 | WP_142925231.1 | polyprenyl synthetase family protein | - |
| M5C55_RS12115 (M5C55_12115) | degQ | 2497510..2497650 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| M5C55_RS12120 (M5C55_12120) | - | 2498116..2498457 (+) | 342 | WP_032876795.1 | hypothetical protein | - |
| M5C55_RS12125 (M5C55_12125) | - | 2498464..2499687 (-) | 1224 | WP_032876792.1 | EAL and HDOD domain-containing protein | - |
| M5C55_RS12130 (M5C55_12130) | - | 2499817..2501283 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| M5C55_RS12135 (M5C55_12135) | - | 2501301..2501852 (-) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| M5C55_RS12140 (M5C55_12140) | - | 2501949..2502347 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=689054 M5C55_RS12115 WP_003152043.1 2497510..2497650(-) (degQ) [Bacillus velezensis strain H208]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=689054 M5C55_RS12115 WP_003152043.1 2497510..2497650(-) (degQ) [Bacillus velezensis strain H208]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |