Detailed information    

insolico Bioinformatically predicted

Overview

Name   cytR   Type   Regulator
Locus tag   M5598_RS14380 Genome accession   NZ_CP097355
Coordinates   3041835..3042842 (+) Length   335 a.a.
NCBI ID   WP_005481416.1    Uniprot ID   A0A072GUT1
Organism   Vibrio parahaemolyticus strain 16-VB00198     
Function   promote competence gene expression (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3016843..3075895 3041835..3042842 within 0


Gene organization within MGE regions


Location: 3016843..3075895
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M5598_RS14190 (M5598_14175) cpdB 3017428..3019389 (+) 1962 WP_031818331.1 2',3'-cyclic-nucleotide 2'-phosphodiesterase -
  M5598_RS14195 (M5598_14180) - 3019498..3020070 (+) 573 WP_031818332.1 Crp/Fnr family transcriptional regulator -
  M5598_RS14200 (M5598_14185) - 3020145..3020255 (-) 111 Protein_2633 IS200/IS605 family transposase -
  M5598_RS14205 (M5598_14190) dbpA 3020402..3021781 (-) 1380 WP_031818333.1 ATP-dependent RNA helicase DbpA -
  M5598_RS14210 (M5598_14195) - 3021928..3022389 (+) 462 WP_031818334.1 GNAT family N-acetyltransferase -
  M5598_RS14215 (M5598_14200) - 3022456..3023055 (-) 600 WP_031818335.1 LysM-like peptidoglycan-binding domain-containing protein -
  M5598_RS14220 (M5598_14205) - 3023288..3023908 (+) 621 WP_005496936.1 FKBP-type peptidyl-prolyl cis-trans isomerase -
  M5598_RS14225 (M5598_14210) - 3024048..3024527 (+) 480 WP_017449005.1 DUF2780 domain-containing protein -
  M5598_RS14230 (M5598_14215) rplQ 3024666..3025046 (-) 381 WP_031818336.1 50S ribosomal protein L17 -
  M5598_RS14235 (M5598_14220) - 3025073..3026065 (-) 993 WP_005383143.1 DNA-directed RNA polymerase subunit alpha -
  M5598_RS14240 (M5598_14225) rpsD 3026090..3026710 (-) 621 WP_005383146.1 30S ribosomal protein S4 -
  M5598_RS14245 (M5598_14230) rpsK 3026738..3027127 (-) 390 WP_001118870.1 30S ribosomal protein S11 -
  M5598_RS14250 (M5598_14235) rpsM 3027146..3027502 (-) 357 WP_005450559.1 30S ribosomal protein S13 -
  M5598_RS14255 (M5598_14240) rpmJ 3027652..3027765 (-) 114 WP_000868186.1 50S ribosomal protein L36 -
  M5598_RS14260 (M5598_14245) secY 3027804..3029138 (-) 1335 WP_005481401.1 preprotein translocase subunit SecY -
  M5598_RS14265 (M5598_14250) rplO 3029159..3029593 (-) 435 WP_005450562.1 50S ribosomal protein L15 -
  M5598_RS14270 (M5598_14255) rpmD 3029599..3029775 (-) 177 WP_000201159.1 50S ribosomal protein L30 -
  M5598_RS14275 (M5598_14260) rpsE 3029783..3030286 (-) 504 WP_005435090.1 30S ribosomal protein S5 -
  M5598_RS14280 (M5598_14265) rplR 3030301..3030654 (-) 354 WP_005435088.1 50S ribosomal protein L18 -
  M5598_RS14285 (M5598_14270) rplF 3030664..3031197 (-) 534 WP_005455654.1 50S ribosomal protein L6 -
  M5598_RS14290 (M5598_14275) rpsH 3031210..3031602 (-) 393 WP_005455656.1 30S ribosomal protein S8 -
  M5598_RS14295 (M5598_14280) rpsN 3031632..3031937 (-) 306 WP_005455658.1 30S ribosomal protein S14 -
  M5598_RS14300 (M5598_14285) rplE 3031955..3032494 (-) 540 WP_005455660.1 50S ribosomal protein L5 -
  M5598_RS14305 (M5598_14290) rplX 3032518..3032835 (-) 318 WP_005455662.1 50S ribosomal protein L24 -
  M5598_RS14310 (M5598_14295) rplN 3032849..3033220 (-) 372 WP_005489425.1 50S ribosomal protein L14 -
  M5598_RS14315 (M5598_14300) rpsQ 3033383..3033637 (-) 255 WP_005461671.1 30S ribosomal protein S17 -
  M5598_RS14320 (M5598_14305) rpmC 3033637..3033828 (-) 192 WP_005379576.1 50S ribosomal protein L29 -
  M5598_RS14325 (M5598_14310) rplP 3033828..3034238 (-) 411 WP_005379577.1 50S ribosomal protein L16 -
  M5598_RS14330 (M5598_14315) rpsC 3034250..3034948 (-) 699 WP_005383161.1 30S ribosomal protein S3 -
  M5598_RS14335 (M5598_14320) rplV 3034967..3035299 (-) 333 WP_005383164.1 50S ribosomal protein L22 -
  M5598_RS14340 (M5598_14325) rpsS 3035310..3035588 (-) 279 WP_004394525.1 30S ribosomal protein S19 -
  M5598_RS14345 (M5598_14330) rplB 3035610..3036434 (-) 825 WP_005489461.1 50S ribosomal protein L2 -
  M5598_RS14350 (M5598_14335) rplW 3036450..3036752 (-) 303 WP_004398471.1 50S ribosomal protein L23 -
  M5598_RS14355 (M5598_14340) rplD 3036749..3037351 (-) 603 WP_005379556.1 50S ribosomal protein L4 -
  M5598_RS14360 (M5598_14345) rplC 3037369..3037998 (-) 630 WP_005456132.1 50S ribosomal protein L3 -
  M5598_RS14365 (M5598_14350) rpsJ 3038013..3038324 (-) 312 WP_004410492.1 30S ribosomal protein S10 -
  M5598_RS14370 (M5598_14355) rpmE 3038782..3039003 (-) 222 WP_005457203.1 50S ribosomal protein L31 -
  M5598_RS14375 (M5598_14360) priA 3039298..3041502 (+) 2205 WP_025622698.1 primosomal protein N' -
  M5598_RS14380 (M5598_14365) cytR 3041835..3042842 (+) 1008 WP_005481416.1 DNA-binding transcriptional regulator CytR Regulator
  M5598_RS14385 (M5598_14370) ftsN 3043019..3043564 (+) 546 WP_005489623.1 cell division protein FtsN -
  M5598_RS14390 (M5598_14375) hslV 3043728..3044279 (+) 552 WP_005489705.1 ATP-dependent protease subunit HslV -
  M5598_RS14395 (M5598_14380) hslU 3044303..3045634 (+) 1332 WP_005489452.1 HslU--HslV peptidase ATPase subunit -
  M5598_RS14400 (M5598_14385) - 3045819..3046736 (+) 918 WP_005457195.1 1,4-dihydroxy-2-naphthoate polyprenyltransferase -
  M5598_RS14405 (M5598_14390) rraA 3046813..3047325 (+) 513 WP_005457192.1 ribonuclease E activity regulator RraA -
  M5598_RS14410 (M5598_14395) zapB 3047430..3047672 (-) 243 WP_005481417.1 cell division protein ZapB -
  M5598_RS14415 (M5598_14400) glpX 3048019..3049026 (+) 1008 WP_031818340.1 class II fructose-bisphosphatase -
  M5598_RS14420 (M5598_14405) - 3049172..3049786 (+) 615 WP_031818341.1 metalloregulator ArsR/SmtB family transcription factor -
  M5598_RS14425 (M5598_14410) - 3049891..3050247 (+) 357 WP_031818342.1 DUF3135 domain-containing protein -
  M5598_RS14430 (M5598_14415) - 3050288..3050710 (-) 423 WP_005458874.1 DUF805 domain-containing protein -
  M5598_RS14435 (M5598_14420) - 3050809..3051156 (-) 348 WP_029864975.1 5-carboxymethyl-2-hydroxymuconate Delta-isomerase -
  M5598_RS14440 (M5598_14425) tpiA 3051427..3052197 (+) 771 WP_031818343.1 triose-phosphate isomerase -
  M5598_RS14445 (M5598_14430) galU 3052295..3053173 (-) 879 WP_031818344.1 UTP--glucose-1-phosphate uridylyltransferase GalU -
  M5598_RS14450 (M5598_14435) - 3053242..3054408 (-) 1167 WP_031818345.1 nucleotide sugar dehydrogenase -
  M5598_RS14455 (M5598_14440) - 3054738..3056471 (+) 1734 WP_050482193.1 glycosyltransferase family 2 protein -
  M5598_RS14460 (M5598_14445) - 3056461..3057693 (+) 1233 WP_031818347.1 glycosyltransferase family 4 protein -
  M5598_RS14465 (M5598_14450) - 3057770..3060028 (+) 2259 WP_228071148.1 glycosyltransferase -
  M5598_RS14470 (M5598_14455) - 3060103..3061476 (+) 1374 WP_228086327.1 hypothetical protein -
  M5598_RS14475 (M5598_14460) - 3061664..3063412 (+) 1749 WP_031818352.1 SLC13 family permease -
  M5598_RS14480 (M5598_14465) - 3063559..3064392 (+) 834 WP_194943962.1 glycosyltransferase family 2 protein -
  M5598_RS14485 (M5598_14470) - 3064425..3065288 (-) 864 WP_031818354.1 glycosyltransferase family 2 protein -
  M5598_RS14490 (M5598_14475) - 3065374..3066417 (-) 1044 WP_031818355.1 hypothetical protein -
  M5598_RS14495 (M5598_14480) - 3066497..3068023 (-) 1527 WP_031818356.1 hypothetical protein -
  M5598_RS14500 (M5598_14485) - 3068037..3069242 (-) 1206 WP_228086326.1 sulfotransferase domain-containing protein -
  M5598_RS14505 (M5598_14490) - 3069405..3072680 (-) 3276 WP_228086325.1 glycosyltransferase -
  M5598_RS14515 (M5598_14500) galU 3074722..3075612 (-) 891 WP_031817812.1 UTP--glucose-1-phosphate uridylyltransferase GalU -

Sequence

Protein


Download         Length: 335 a.a.        Molecular weight: 36835.35 Da        Isoelectric Point: 6.4938

>NTDB_id=688994 M5598_RS14380 WP_005481416.1 3041835..3042842(+) (cytR) [Vibrio parahaemolyticus strain 16-VB00198]
MATMKDVAQLAGVSTATVSRALMNPEKVSSSTRKRVEDAVLEAGYSPNSLARNLRRNESKTIVTIVPDICDPYFSEIIRG
IEDAAMEHGYLVLLGDSGQQKKRESSFVNLVFTKQADGMLLLGTDLPFDVSKPEQKNLPPMVMACEFAPELELPTVHIDN
LTSAFEAVNYLTQLGHKRIAQISGPDTAVLCQFRQQGYQQALRRAGISKDPQYSVITEFSFDGGAKAVRKLLELPEPPTA
IFCHCDTMAIGAIQEAKRLGLRVPQDLSVVGFDDINFAQYCDPPLTTISQPRYEIGRQAMLMMLELLKGHDVHSGSRLLE
TKLVVRGSAAPPQRA

Nucleotide


Download         Length: 1008 bp        

>NTDB_id=688994 M5598_RS14380 WP_005481416.1 3041835..3042842(+) (cytR) [Vibrio parahaemolyticus strain 16-VB00198]
ATGGCGACAATGAAGGATGTTGCCCAGCTTGCGGGAGTGTCGACAGCTACGGTATCTCGAGCATTAATGAATCCAGAAAA
AGTCTCTTCTTCAACAAGAAAAAGAGTCGAAGATGCCGTCCTTGAAGCGGGCTATTCTCCAAATTCATTAGCGCGTAATC
TACGTAGAAACGAATCAAAAACGATTGTTACCATCGTTCCTGACATCTGTGATCCTTATTTTTCTGAAATCATTCGTGGT
ATCGAAGACGCCGCTATGGAACATGGCTACCTCGTACTGCTCGGTGACAGCGGCCAGCAGAAAAAGCGTGAAAGCTCGTT
TGTGAATCTAGTGTTCACCAAACAAGCCGATGGCATGTTACTGCTTGGCACCGACCTGCCATTTGATGTCAGCAAGCCAG
AACAGAAAAACCTGCCACCCATGGTCATGGCTTGTGAGTTTGCGCCAGAGCTAGAATTACCAACCGTGCACATTGACAAC
CTAACGTCTGCTTTTGAAGCGGTCAATTACCTAACTCAGCTTGGCCATAAACGCATAGCACAAATTTCAGGGCCAGACAC
AGCGGTGTTGTGTCAGTTCCGCCAGCAAGGTTATCAACAAGCCTTGCGTCGCGCGGGGATCAGTAAAGACCCACAATACA
GCGTTATCACTGAGTTTTCTTTTGACGGCGGCGCGAAAGCTGTACGTAAGTTGCTAGAACTTCCAGAGCCACCAACTGCG
ATTTTCTGCCATTGCGACACCATGGCAATCGGCGCAATCCAAGAAGCGAAACGACTCGGTCTGCGCGTTCCGCAAGATCT
GTCAGTGGTTGGTTTCGATGATATCAACTTTGCTCAATACTGCGATCCACCGTTAACGACCATTTCTCAACCTCGTTATG
AAATTGGCCGCCAAGCGATGCTTATGATGCTTGAACTACTTAAAGGCCATGACGTTCATTCAGGTTCACGCTTACTAGAA
ACTAAGCTTGTTGTCCGTGGTAGCGCAGCGCCACCGCAACGCGCCTAA

Domains

Predicted by InterproScan.

Bacterial regulatory proteins, lacI family (LacI)

(3-48)

Periplasmic binding protein-like domain (Peripla_BP_3)

(168-328)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A072GUT1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cytR Vibrio parahaemolyticus RIMD 2210633

100

100

1
  cytR Vibrio cholerae C6706

90.719

99.701

0.904