Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | M6D84_RS10285 | Genome accession | NZ_CP097351 |
| Coordinates | 2002990..2003268 (+) | Length | 92 a.a. |
| NCBI ID | WP_048558227.1 | Uniprot ID | A0A9X0KHU4 |
| Organism | Bacillus cereus strain DQ01 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1992945..2038180 | 2002990..2003268 | within | 0 |
Gene organization within MGE regions
Location: 1992945..2038180
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M6D84_RS10210 (M6D84_10210) | - | 1992945..1994114 (+) | 1170 | WP_000588618.1 | DEAD/DEAH box helicase | - |
| M6D84_RS10215 (M6D84_10215) | - | 1994333..1995142 (+) | 810 | WP_048558215.1 | sugar phosphate isomerase/epimerase family protein | - |
| M6D84_RS10220 (M6D84_10220) | - | 1995198..1995374 (+) | 177 | Protein_1940 | VOC family protein | - |
| M6D84_RS10225 (M6D84_10225) | - | 1995457..1996566 (-) | 1110 | WP_048558216.1 | site-specific integrase | - |
| M6D84_RS10230 (M6D84_10230) | - | 1996768..1996950 (+) | 183 | WP_048558217.1 | hypothetical protein | - |
| M6D84_RS10235 (M6D84_10235) | - | 1997076..1997429 (-) | 354 | WP_048558286.1 | helix-turn-helix transcriptional regulator | - |
| M6D84_RS10240 (M6D84_10240) | - | 1997928..1999070 (+) | 1143 | WP_249762131.1 | AimR family lysis-lysogeny pheromone receptor | - |
| M6D84_RS10245 (M6D84_10245) | - | 1999103..1999255 (+) | 153 | WP_154400985.1 | hypothetical protein | - |
| M6D84_RS29170 | - | 1999385..1999507 (+) | 123 | WP_255259040.1 | hypothetical protein | - |
| M6D84_RS10250 (M6D84_10250) | - | 1999521..1999865 (-) | 345 | WP_048558219.1 | helix-turn-helix transcriptional regulator | - |
| M6D84_RS10255 (M6D84_10255) | - | 2000093..2000332 (+) | 240 | WP_048558220.1 | helix-turn-helix transcriptional regulator | - |
| M6D84_RS10260 (M6D84_10260) | - | 2000416..2000682 (+) | 267 | WP_048558221.1 | helix-turn-helix domain-containing protein | - |
| M6D84_RS10265 (M6D84_10265) | - | 2000876..2001052 (+) | 177 | WP_048558223.1 | hypothetical protein | - |
| M6D84_RS10270 (M6D84_10270) | - | 2001059..2001949 (+) | 891 | WP_048558224.1 | DnaD domain protein | - |
| M6D84_RS10275 (M6D84_10275) | - | 2001888..2002763 (+) | 876 | WP_048558225.1 | ATP-binding protein | - |
| M6D84_RS10280 (M6D84_10280) | - | 2002779..2002973 (+) | 195 | WP_048558226.1 | hypothetical protein | - |
| M6D84_RS10285 (M6D84_10285) | abrB | 2002990..2003268 (+) | 279 | WP_048558227.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| M6D84_RS10290 (M6D84_10290) | - | 2003261..2003620 (+) | 360 | WP_048558228.1 | hypothetical protein | - |
| M6D84_RS10295 (M6D84_10295) | - | 2003640..2003807 (+) | 168 | WP_000717825.1 | DUF3954 domain-containing protein | - |
| M6D84_RS10300 (M6D84_10300) | - | 2003833..2004084 (+) | 252 | WP_048558229.1 | hypothetical protein | - |
| M6D84_RS10305 (M6D84_10305) | - | 2004104..2004613 (+) | 510 | WP_048558230.1 | dUTP diphosphatase | - |
| M6D84_RS10310 (M6D84_10310) | - | 2004652..2004951 (+) | 300 | WP_048558231.1 | hypothetical protein | - |
| M6D84_RS10315 (M6D84_10315) | - | 2005114..2005659 (+) | 546 | WP_048558232.1 | hypothetical protein | - |
| M6D84_RS10320 (M6D84_10320) | - | 2005711..2006061 (+) | 351 | WP_249762132.1 | hypothetical protein | - |
| M6D84_RS10325 (M6D84_10325) | - | 2006102..2006941 (+) | 840 | WP_048558234.1 | phosphoadenosine phosphosulfate reductase family protein | - |
| M6D84_RS10330 (M6D84_10330) | - | 2006978..2007121 (+) | 144 | WP_193388465.1 | hypothetical protein | - |
| M6D84_RS10335 (M6D84_10335) | - | 2007234..2007398 (-) | 165 | WP_000140899.1 | hypothetical protein | - |
| M6D84_RS10340 (M6D84_10340) | - | 2007501..2007623 (+) | 123 | WP_048558235.1 | DUF3983 domain-containing protein | - |
| M6D84_RS10345 (M6D84_10345) | - | 2007739..2007909 (+) | 171 | WP_048558236.1 | hypothetical protein | - |
| M6D84_RS10350 (M6D84_10350) | - | 2007937..2008419 (+) | 483 | WP_048558237.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| M6D84_RS10355 (M6D84_10355) | - | 2008419..2008961 (+) | 543 | WP_048558238.1 | site-specific integrase | - |
| M6D84_RS10360 (M6D84_10360) | - | 2009139..2010284 (+) | 1146 | WP_048558239.1 | SEC-C domain-containing protein | - |
| M6D84_RS29290 | - | 2010634..2010984 (+) | 351 | WP_306559322.1 | hypothetical protein | - |
| M6D84_RS10370 (M6D84_10370) | - | 2010997..2011212 (+) | 216 | WP_048558240.1 | hypothetical protein | - |
| M6D84_RS10375 (M6D84_10375) | - | 2011346..2011660 (+) | 315 | WP_048558241.1 | helix-turn-helix domain-containing protein | - |
| M6D84_RS10380 (M6D84_10380) | - | 2011626..2011961 (+) | 336 | WP_048558242.1 | HNH endonuclease | - |
| M6D84_RS10385 (M6D84_10385) | - | 2012114..2012449 (+) | 336 | WP_000124842.1 | P27 family phage terminase small subunit | - |
| M6D84_RS10390 (M6D84_10390) | - | 2012446..2014104 (+) | 1659 | WP_000615659.1 | terminase TerL endonuclease subunit | - |
| M6D84_RS10395 (M6D84_10395) | - | 2014170..2015276 (+) | 1107 | WP_048558288.1 | phage portal protein | - |
| M6D84_RS10400 (M6D84_10400) | - | 2015260..2016042 (+) | 783 | WP_048558243.1 | head maturation protease, ClpP-related | - |
| M6D84_RS10405 (M6D84_10405) | - | 2016046..2017200 (+) | 1155 | WP_000234872.1 | phage major capsid protein | - |
| M6D84_RS10410 (M6D84_10410) | - | 2017206..2017499 (+) | 294 | WP_048558244.1 | hypothetical protein | - |
| M6D84_RS10415 (M6D84_10415) | - | 2017501..2017854 (+) | 354 | WP_048558245.1 | phage head closure protein | - |
| M6D84_RS10420 (M6D84_10420) | - | 2017856..2018200 (+) | 345 | WP_048558246.1 | HK97 gp10 family phage protein | - |
| M6D84_RS10425 (M6D84_10425) | - | 2018197..2018526 (+) | 330 | WP_048558247.1 | hypothetical protein | - |
| M6D84_RS10430 (M6D84_10430) | - | 2018527..2019120 (+) | 594 | WP_048558248.1 | major tail protein | - |
| M6D84_RS10435 (M6D84_10435) | - | 2019127..2019483 (+) | 357 | WP_048558249.1 | hypothetical protein | - |
| M6D84_RS10440 (M6D84_10440) | - | 2019714..2020922 (+) | 1209 | Protein_1985 | hypothetical protein | - |
| M6D84_RS10445 (M6D84_10445) | - | 2021180..2021437 (+) | 258 | WP_048558251.1 | hypothetical protein | - |
| M6D84_RS10450 (M6D84_10450) | - | 2021661..2023850 (+) | 2190 | WP_048558252.1 | membrane protein | - |
| M6D84_RS10455 (M6D84_10455) | - | 2023892..2025364 (+) | 1473 | WP_048558253.1 | distal tail protein Dit | - |
| M6D84_RS10460 (M6D84_10460) | - | 2025361..2031381 (+) | 6021 | WP_239661367.1 | phage tail spike protein | - |
| M6D84_RS10465 (M6D84_10465) | - | 2031419..2031655 (+) | 237 | WP_016081457.1 | hemolysin XhlA family protein | - |
| M6D84_RS10470 (M6D84_10470) | - | 2031655..2031894 (+) | 240 | WP_000461725.1 | hypothetical protein | - |
| M6D84_RS10475 (M6D84_10475) | - | 2031891..2032955 (+) | 1065 | WP_048558254.1 | N-acetylmuramoyl-L-alanine amidase | - |
| M6D84_RS10480 (M6D84_10480) | - | 2033084..2034130 (-) | 1047 | WP_048558255.1 | hypothetical protein | - |
| M6D84_RS10485 (M6D84_10485) | - | 2034419..2034622 (-) | 204 | WP_048558256.1 | helix-turn-helix domain-containing protein | - |
| M6D84_RS10490 (M6D84_10490) | - | 2034786..2035088 (+) | 303 | WP_048558257.1 | hypothetical protein | - |
| M6D84_RS10495 (M6D84_10495) | - | 2035091..2035273 (+) | 183 | WP_048558258.1 | hypothetical protein | - |
| M6D84_RS10500 (M6D84_10500) | - | 2035389..2036570 (+) | 1182 | WP_048558259.1 | FtsK/SpoIIIE domain-containing protein | - |
| M6D84_RS10505 (M6D84_10505) | - | 2036512..2037135 (+) | 624 | WP_048558260.1 | replication-relaxation family protein | - |
| M6D84_RS10510 (M6D84_10510) | - | 2037275..2037496 (+) | 222 | Protein_1999 | VOC family protein | - |
| M6D84_RS10515 (M6D84_10515) | - | 2037542..2038180 (-) | 639 | WP_000535630.1 | zinc dependent phospholipase C family protein | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10133.74 Da Isoelectric Point: 6.2299
>NTDB_id=688934 M6D84_RS10285 WP_048558227.1 2002990..2003268(+) (abrB) [Bacillus cereus strain DQ01]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALGFHVEGENIVLRKHEKSCFVTGKVSESNIELLDGRMFLSKEGATEL
LDILEKSEMVHG
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALGFHVEGENIVLRKHEKSCFVTGKVSESNIELLDGRMFLSKEGATEL
LDILEKSEMVHG
Nucleotide
Download Length: 279 bp
>NTDB_id=688934 M6D84_RS10285 WP_048558227.1 2002990..2003268(+) (abrB) [Bacillus cereus strain DQ01]
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGGCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
AATTGCTGAAGGTACAGCGTTAGGCTTCCATGTTGAAGGGGAAAACATTGTTTTAAGAAAACACGAAAAGTCATGCTTTG
TAACTGGCAAAGTTTCTGAATCAAACATTGAATTGCTGGATGGAAGAATGTTTTTAAGTAAAGAAGGAGCAACTGAATTA
CTGGACATTCTTGAAAAGAGTGAAATGGTACATGGCTAA
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGGCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
AATTGCTGAAGGTACAGCGTTAGGCTTCCATGTTGAAGGGGAAAACATTGTTTTAAGAAAACACGAAAAGTCATGCTTTG
TAACTGGCAAAGTTTCTGAATCAAACATTGAATTGCTGGATGGAAGAATGTTTTTAAGTAAAGAAGGAGCAACTGAATTA
CTGGACATTCTTGAAAAGAGTGAAATGGTACATGGCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
57.831 |
90.217 |
0.522 |