Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   M3Y14_RS19605 Genome accession   NZ_CP097257
Coordinates   3743492..3743770 (-) Length   92 a.a.
NCBI ID   WP_264539061.1    Uniprot ID   -
Organism   Bacillus thuringiensis strain Bt Gxmzu777-1     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3731141..3764539 3743492..3743770 within 0


Gene organization within MGE regions


Location: 3731141..3764539
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M3Y14_RS19505 (M3Y14_19435) ftsL 3731262..3731624 (-) 363 WP_002014745.1 cell division protein FtsL -
  M3Y14_RS19510 (M3Y14_19440) rsmH 3731640..3732572 (-) 933 WP_002014746.1 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH -
  M3Y14_RS19515 (M3Y14_19445) bshC 3732939..3734555 (-) 1617 WP_264539052.1 bacillithiol biosynthesis cysteine-adding enzyme BshC -
  M3Y14_RS19520 (M3Y14_19450) panE 3734635..3735522 (-) 888 WP_219919778.1 2-dehydropantoate 2-reductase -
  M3Y14_RS19525 (M3Y14_19455) - 3735818..3736291 (+) 474 WP_219919779.1 N-acetyltransferase -
  M3Y14_RS19530 (M3Y14_19460) - 3736325..3736831 (-) 507 WP_219919780.1 RsfA family transcriptional regulator -
  M3Y14_RS19535 (M3Y14_19465) rpmF 3736961..3737134 (-) 174 WP_001984764.1 50S ribosomal protein L32 -
  M3Y14_RS19540 (M3Y14_19470) - 3737196..3737696 (-) 501 WP_215572001.1 YceD family protein -
  M3Y14_RS19545 (M3Y14_19475) - 3737980..3738597 (-) 618 WP_128853647.1 replication-relaxation family protein -
  M3Y14_RS19550 (M3Y14_19480) - 3738539..3739720 (-) 1182 WP_264539053.1 FtsK/SpoIIIE domain-containing protein -
  M3Y14_RS19555 (M3Y14_19485) - 3739838..3740020 (-) 183 WP_264539054.1 hypothetical protein -
  M3Y14_RS19560 (M3Y14_19490) - 3740023..3740325 (-) 303 WP_264539055.1 hypothetical protein -
  M3Y14_RS19565 (M3Y14_19495) - 3740478..3740681 (+) 204 WP_128853643.1 helix-turn-helix transcriptional regulator -
  M3Y14_RS19570 (M3Y14_19500) - 3740759..3741091 (+) 333 WP_264539056.1 hypothetical protein -
  M3Y14_RS19575 (M3Y14_19505) - 3741564..3741986 (-) 423 WP_264539057.1 hypothetical protein -
  M3Y14_RS19580 (M3Y14_19510) - 3742023..3742163 (-) 141 WP_098204559.1 hypothetical protein -
  M3Y14_RS19585 (M3Y14_19515) - 3742204..3742659 (-) 456 WP_264539058.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  M3Y14_RS19590 (M3Y14_19520) - 3742677..3742928 (-) 252 WP_106082335.1 helix-turn-helix domain containing protein -
  M3Y14_RS19595 (M3Y14_19525) - 3742954..3743121 (-) 168 WP_264539059.1 DUF3954 domain-containing protein -
  M3Y14_RS19600 (M3Y14_19530) - 3743140..3743499 (-) 360 WP_264539060.1 cell division protein SepF -
  M3Y14_RS19605 (M3Y14_19535) abrB 3743492..3743770 (-) 279 WP_264539061.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  M3Y14_RS19610 (M3Y14_19540) - 3743786..3743980 (-) 195 WP_106082338.1 hypothetical protein -
  M3Y14_RS19615 (M3Y14_19545) - 3743983..3744846 (-) 864 WP_264539062.1 ATP-binding protein -
  M3Y14_RS19620 (M3Y14_19550) - 3744788..3745651 (-) 864 WP_264539063.1 phage replisome organizer N-terminal domain-containing protein -
  M3Y14_RS19625 (M3Y14_19555) - 3745657..3745833 (-) 177 WP_172805408.1 hypothetical protein -
  M3Y14_RS19630 (M3Y14_19560) - 3745881..3746027 (-) 147 WP_172805407.1 hypothetical protein -
  M3Y14_RS19635 (M3Y14_19565) - 3746084..3746284 (-) 201 WP_002138080.1 helix-turn-helix domain-containing protein -
  M3Y14_RS19640 (M3Y14_19570) - 3746393..3746587 (-) 195 WP_002138084.1 helix-turn-helix domain-containing protein -
  M3Y14_RS19645 (M3Y14_19575) - 3746757..3747113 (+) 357 WP_078204459.1 helix-turn-helix domain-containing protein -
  M3Y14_RS19650 (M3Y14_19580) - 3747110..3747307 (-) 198 WP_264539064.1 hypothetical protein -
  M3Y14_RS19655 (M3Y14_19585) - 3747435..3747548 (-) 114 WP_264539065.1 ABC transporter ATP-binding protein -
  M3Y14_RS19660 (M3Y14_19590) - 3747571..3748716 (-) 1146 WP_264539066.1 AimR family lysis-lysogeny pheromone receptor -
  M3Y14_RS19665 (M3Y14_19595) - 3749153..3749497 (+) 345 WP_002138090.1 helix-turn-helix domain-containing protein -
  M3Y14_RS19670 (M3Y14_19600) - 3749588..3749767 (-) 180 WP_264539067.1 hypothetical protein -
  M3Y14_RS19675 (M3Y14_19605) - 3749787..3749936 (-) 150 WP_264539068.1 hypothetical protein -
  M3Y14_RS19680 (M3Y14_19610) - 3750097..3751227 (+) 1131 WP_264539069.1 site-specific integrase -
  M3Y14_RS19685 (M3Y14_19615) - 3751362..3752603 (+) 1242 WP_219921073.1 nucleotidyltransferase -
  M3Y14_RS19690 (M3Y14_19620) - 3752630..3753655 (-) 1026 WP_264539070.1 SepM family pheromone-processing serine protease -
  M3Y14_RS19695 (M3Y14_19625) - 3753648..3754439 (-) 792 WP_098778504.1 patatin-like phospholipase family protein -
  M3Y14_RS19700 (M3Y14_19630) ylbJ 3754552..3755781 (+) 1230 WP_264539071.1 sporulation integral membrane protein YlbJ -
  M3Y14_RS19705 (M3Y14_19635) coaD 3755773..3756264 (-) 492 WP_002088286.1 pantetheine-phosphate adenylyltransferase -
  M3Y14_RS19710 (M3Y14_19640) rsmD 3756261..3756827 (-) 567 WP_219919785.1 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  M3Y14_RS19715 (M3Y14_19645) - 3757343..3757732 (+) 390 WP_264539072.1 methylthioribose kinase -
  M3Y14_RS19720 (M3Y14_19650) - 3757788..3758054 (-) 267 WP_002088292.1 YlbG family protein -
  M3Y14_RS19725 (M3Y14_19655) - 3758182..3758634 (-) 453 WP_070144653.1 YlbF family regulator -
  M3Y14_RS19730 (M3Y14_19660) - 3758751..3759323 (-) 573 WP_219919789.1 histidine phosphatase family protein -
  M3Y14_RS19735 (M3Y14_19665) - 3759401..3759646 (-) 246 WP_219919791.1 YlbE-like family protein -
  M3Y14_RS19740 (M3Y14_19670) - 3759658..3760095 (-) 438 WP_264539073.1 YlbD family protein -
  M3Y14_RS19745 (M3Y14_19675) - 3760330..3761364 (-) 1035 WP_219919795.1 CAP domain-containing protein -
  M3Y14_RS19750 (M3Y14_19680) - 3761573..3761938 (+) 366 WP_002066906.1 YugN family protein -
  M3Y14_RS19755 (M3Y14_19685) - 3761985..3762983 (-) 999 WP_264539074.1 formamidase -
  M3Y14_RS19760 (M3Y14_19690) ctaG 3763371..3764276 (-) 906 WP_264541220.1 cytochrome c oxidase assembly factor CtaG -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 9946.48 Da        Isoelectric Point: 6.7189

>NTDB_id=688163 M3Y14_RS19605 WP_264539061.1 3743492..3743770(-) (abrB) [Bacillus thuringiensis strain Bt Gxmzu777-1]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTTLDFHVDGANIVLRKHEKSCFVTGEVSESNIELLSGRMFLSKEGASEL
LGLLEKSGIAHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=688163 M3Y14_RS19605 WP_264539061.1 3743492..3743770(-) (abrB) [Bacillus thuringiensis strain Bt Gxmzu777-1]
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGGCGTGTAGTAATTCCGGTTGAGTTACGCAGAACTTTGGG
GATTGCTGAAGGAACGACATTAGACTTTCATGTTGATGGGGCAAACATCGTTTTAAGAAAACATGAAAAATCATGTTTTG
TAACAGGTGAAGTTTCTGAATCAAACATAGAATTGCTGAGCGGACGAATGTTTTTGAGTAAGGAAGGGGCAAGTGAGTTA
CTGGGCCTTCTTGAAAAGAGTGGGATAGCACATGCCTAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(52-85)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-49)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

57.831

90.217

0.522