Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   M3Y14_RS17835 Genome accession   NZ_CP097257
Coordinates   3406802..3407080 (-) Length   92 a.a.
NCBI ID   WP_264538933.1    Uniprot ID   -
Organism   Bacillus thuringiensis strain Bt Gxmzu777-1     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3397697..3417720 3406802..3407080 within 0


Gene organization within MGE regions


Location: 3397697..3417720
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M3Y14_RS17735 (M3Y14_17670) - 3397697..3398347 (-) 651 WP_264538918.1 ABC-2 transporter permease -
  M3Y14_RS17740 (M3Y14_17675) - 3398348..3399199 (-) 852 WP_016096348.1 ABC transporter ATP-binding protein -
  M3Y14_RS17745 (M3Y14_17680) - 3399258..3399422 (-) 165 Protein_3519 transcriptional regulator -
  M3Y14_RS17750 (M3Y14_17685) - 3399563..3400180 (-) 618 WP_264538919.1 replication-relaxation family protein -
  M3Y14_RS17755 (M3Y14_17690) - 3400122..3401306 (-) 1185 WP_264538920.1 FtsK/SpoIIIE domain-containing protein -
  M3Y14_RS17760 (M3Y14_17695) - 3401425..3401607 (-) 183 WP_264538921.1 hypothetical protein -
  M3Y14_RS17765 (M3Y14_17700) - 3401604..3401906 (-) 303 WP_242242729.1 hypothetical protein -
  M3Y14_RS17770 (M3Y14_17705) - 3402070..3402267 (+) 198 WP_264538922.1 helix-turn-helix transcriptional regulator -
  M3Y14_RS17775 (M3Y14_17710) - 3402524..3402715 (+) 192 WP_264538923.1 hypothetical protein -
  M3Y14_RS17780 (M3Y14_17715) - 3402731..3402997 (+) 267 WP_264538924.1 hypothetical protein -
  M3Y14_RS17785 (M3Y14_17720) - 3403306..3403389 (-) 84 Protein_3527 N-acetylmuramoyl-L-alanine amidase C-terminal domain-containing protein -
  M3Y14_RS17790 (M3Y14_17725) - 3403473..3403628 (-) 156 WP_264538925.1 hypothetical protein -
  M3Y14_RS17795 (M3Y14_17730) - 3403803..3403979 (-) 177 WP_264538926.1 hypothetical protein -
  M3Y14_RS17800 (M3Y14_17735) - 3404018..3404416 (-) 399 WP_264538927.1 hypothetical protein -
  M3Y14_RS17805 (M3Y14_17740) - 3404452..3404658 (-) 207 WP_264538928.1 hypothetical protein -
  M3Y14_RS17810 (M3Y14_17745) - 3404693..3405292 (-) 600 WP_264538929.1 hypothetical protein -
  M3Y14_RS17815 (M3Y14_17750) - 3405739..3405966 (-) 228 WP_264538930.1 hypothetical protein -
  M3Y14_RS17820 (M3Y14_17755) - 3405987..3406238 (-) 252 WP_000109495.1 hypothetical protein -
  M3Y14_RS17825 (M3Y14_17760) - 3406264..3406431 (-) 168 WP_264538931.1 DUF3954 domain-containing protein -
  M3Y14_RS17830 (M3Y14_17765) - 3406450..3406809 (-) 360 WP_264538932.1 cell division protein SepF -
  M3Y14_RS17835 (M3Y14_17770) abrB 3406802..3407080 (-) 279 WP_264538933.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  M3Y14_RS17840 (M3Y14_17775) - 3407097..3407291 (-) 195 WP_264538934.1 hypothetical protein -
  M3Y14_RS17845 (M3Y14_17780) - 3407304..3408218 (-) 915 WP_264538935.1 AAA family ATPase -
  M3Y14_RS17850 (M3Y14_17785) - 3408233..3409114 (-) 882 WP_264538936.1 conserved phage C-terminal domain-containing protein -
  M3Y14_RS17855 (M3Y14_17790) - 3409119..3409274 (-) 156 WP_264541257.1 hypothetical protein -
  M3Y14_RS17860 (M3Y14_17795) - 3409325..3409489 (-) 165 WP_264538937.1 hypothetical protein -
  M3Y14_RS17865 (M3Y14_17800) - 3409525..3409800 (-) 276 WP_264538938.1 helix-turn-helix domain-containing protein -
  M3Y14_RS17870 (M3Y14_17805) - 3409849..3410523 (-) 675 WP_264538939.1 Rha family transcriptional regulator -
  M3Y14_RS17875 (M3Y14_17810) - 3410583..3410801 (-) 219 WP_264538940.1 helix-turn-helix domain-containing protein -
  M3Y14_RS17880 (M3Y14_17815) - 3410978..3411325 (+) 348 WP_264538941.1 helix-turn-helix domain-containing protein -
  M3Y14_RS17885 (M3Y14_17820) - 3411332..3411484 (-) 153 WP_264538942.1 hypothetical protein -
  M3Y14_RS17890 (M3Y14_17825) - 3411775..3412914 (-) 1140 WP_264538943.1 AimR family lysis-lysogeny pheromone receptor -
  M3Y14_RS17895 (M3Y14_17830) - 3413532..3414638 (+) 1107 WP_264538944.1 site-specific integrase -
  M3Y14_RS17900 (M3Y14_17835) - 3414713..3415357 (-) 645 Protein_3550 helix-turn-helix domain-containing protein -
  M3Y14_RS17905 (M3Y14_17840) - 3415622..3416182 (-) 561 Protein_3551 GNAT family N-acetyltransferase -
  M3Y14_RS17910 (M3Y14_17845) - 3416179..3416382 (-) 204 WP_002146302.1 hypothetical protein -
  M3Y14_RS17915 (M3Y14_17850) - 3416533..3417345 (+) 813 WP_002066615.1 hypothetical protein -
  M3Y14_RS17920 (M3Y14_17855) - 3417517..3417720 (+) 204 WP_002066614.1 CsbD family protein -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10049.59 Da        Isoelectric Point: 5.7255

>NTDB_id=688159 M3Y14_RS17835 WP_264538933.1 3406802..3407080(-) (abrB) [Bacillus thuringiensis strain Bt Gxmzu777-1]
MKNTGVVRKVDELGRVVIPVELRRTLGIAEGTALGFHVDGENIILRKHEKSCFVTGEVSESNMEFLGGRMFLSKEGATEL
VDILEKSGMTNG

Nucleotide


Download         Length: 279 bp        

>NTDB_id=688159 M3Y14_RS17835 WP_264538933.1 3406802..3407080(-) (abrB) [Bacillus thuringiensis strain Bt Gxmzu777-1]
ATGAAAAATACAGGTGTTGTAAGAAAAGTGGACGAGCTAGGGCGTGTAGTAATTCCGGTTGAGTTACGAAGAACTTTGGG
GATTGCTGAAGGTACAGCATTAGGTTTTCATGTTGATGGGGAAAACATCATCTTAAGAAAACATGAAAAGTCATGCTTTG
TAACAGGTGAAGTTTCTGAATCAAACATGGAATTTCTAGGTGGTCGAATGTTTTTGAGTAAGGAAGGGGCAACTGAATTA
GTGGACATTCTTGAAAAGAGTGGGATGACAAATGGTTAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(52-86)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-49)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

62.651

90.217

0.565