Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | M2922_RS08260 | Genome accession | NZ_CP097066 |
| Coordinates | 1704339..1704614 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain AT49a | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1662016..1704315 | 1704339..1704614 | flank | 24 |
Gene organization within MGE regions
Location: 1662016..1704614
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2922_RS07960 (M2922_07950) | - | 1662016..1663023 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| M2922_RS07965 (M2922_07955) | comGG | 1663152..1663505 (-) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| M2922_RS07970 (M2922_07960) | comGF | 1663505..1663939 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| M2922_RS07975 (M2922_07965) | - | 1663929..1664300 (-) | 372 | WP_002365830.1 | type II secretion system protein | - |
| M2922_RS13475 | - | 1664634..1664759 (+) | 126 | WP_002364184.1 | hypothetical protein | - |
| M2922_RS07980 (M2922_07970) | hemH | 1665056..1665997 (-) | 942 | WP_033595884.1 | ferrochelatase | - |
| M2922_RS07990 (M2922_07980) | - | 1666741..1666992 (-) | 252 | WP_002364188.1 | hypothetical protein | - |
| M2922_RS07995 (M2922_07985) | - | 1667064..1667264 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| M2922_RS08000 (M2922_07990) | - | 1668101..1669342 (-) | 1242 | WP_002394567.1 | LysM peptidoglycan-binding domain-containing protein | - |
| M2922_RS08005 (M2922_07995) | - | 1669343..1669576 (-) | 234 | WP_002384371.1 | phage holin | - |
| M2922_RS08010 (M2922_08000) | - | 1669569..1669790 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| M2922_RS08015 (M2922_08005) | - | 1669825..1669980 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| M2922_RS08020 (M2922_08010) | - | 1669982..1670302 (-) | 321 | WP_002389262.1 | hypothetical protein | - |
| M2922_RS08025 (M2922_08015) | - | 1670316..1670807 (-) | 492 | WP_002364194.1 | hypothetical protein | - |
| M2922_RS08030 (M2922_08020) | - | 1670807..1671094 (-) | 288 | WP_002357046.1 | collagen-like protein | - |
| M2922_RS08035 (M2922_08025) | - | 1671091..1671687 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| M2922_RS08040 (M2922_08030) | - | 1671680..1672561 (-) | 882 | WP_002387290.1 | phage baseplate upper protein | - |
| M2922_RS08045 (M2922_08035) | - | 1672580..1675387 (-) | 2808 | WP_002410540.1 | phage tail spike protein | - |
| M2922_RS08050 (M2922_08040) | - | 1675369..1676103 (-) | 735 | WP_002403868.1 | tail protein | - |
| M2922_RS08055 (M2922_08045) | - | 1676093..1678990 (-) | 2898 | WP_002410539.1 | tape measure protein | - |
| M2922_RS08060 (M2922_08050) | - | 1679238..1679588 (-) | 351 | WP_002357039.1 | hypothetical protein | - |
| M2922_RS08065 (M2922_08055) | - | 1679641..1680489 (-) | 849 | WP_002387287.1 | major tail protein | - |
| M2922_RS08070 (M2922_08060) | - | 1680490..1680864 (-) | 375 | WP_002387286.1 | DUF6838 family protein | - |
| M2922_RS08075 (M2922_08065) | - | 1680867..1681265 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| M2922_RS08080 (M2922_08070) | - | 1681258..1681626 (-) | 369 | WP_002357034.1 | hypothetical protein | - |
| M2922_RS08085 (M2922_08075) | - | 1681623..1681967 (-) | 345 | WP_002357033.1 | hypothetical protein | - |
| M2922_RS08090 (M2922_08080) | - | 1681981..1682163 (-) | 183 | WP_002357032.1 | hypothetical protein | - |
| M2922_RS08095 (M2922_08085) | - | 1682192..1683079 (-) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| M2922_RS08100 (M2922_08090) | - | 1683093..1683716 (-) | 624 | WP_002393977.1 | DUF4355 domain-containing protein | - |
| M2922_RS08105 (M2922_08095) | - | 1683935..1684255 (-) | 321 | WP_002380436.1 | hypothetical protein | - |
| M2922_RS08110 (M2922_08100) | - | 1684312..1684542 (-) | 231 | WP_002380437.1 | hypothetical protein | - |
| M2922_RS08115 (M2922_08105) | - | 1684543..1686447 (-) | 1905 | WP_002393613.1 | hypothetical protein | - |
| M2922_RS08120 (M2922_08110) | - | 1686422..1687909 (-) | 1488 | WP_002393614.1 | phage portal protein | - |
| M2922_RS08125 (M2922_08115) | - | 1687921..1689210 (-) | 1290 | WP_002393615.1 | PBSX family phage terminase large subunit | - |
| M2922_RS08130 (M2922_08120) | terS | 1689182..1689985 (-) | 804 | WP_010816619.1 | phage terminase small subunit | - |
| M2922_RS08135 (M2922_08125) | - | 1690254..1691171 (+) | 918 | WP_002370955.1 | hypothetical protein | - |
| M2922_RS08140 (M2922_08130) | - | 1691209..1691787 (-) | 579 | WP_002370953.1 | sce7726 family protein | - |
| M2922_RS08145 (M2922_08135) | - | 1691931..1692164 (-) | 234 | WP_002410538.1 | hypothetical protein | - |
| M2922_RS08155 (M2922_08145) | - | 1693160..1693576 (-) | 417 | WP_002372045.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| M2922_RS08160 | - | 1693944..1694204 (-) | 261 | WP_002357017.1 | hypothetical protein | - |
| M2922_RS08165 (M2922_08150) | - | 1694483..1694917 (-) | 435 | WP_002402491.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M2922_RS08170 (M2922_08155) | - | 1694926..1695225 (-) | 300 | WP_002372047.1 | MazG-like family protein | - |
| M2922_RS08175 (M2922_08160) | - | 1695226..1695528 (-) | 303 | WP_002368214.1 | hypothetical protein | - |
| M2922_RS08180 (M2922_08165) | - | 1695525..1696397 (-) | 873 | WP_010715319.1 | helix-turn-helix domain-containing protein | - |
| M2922_RS08185 (M2922_08170) | - | 1696397..1696597 (-) | 201 | WP_010816620.1 | hypothetical protein | - |
| M2922_RS08190 (M2922_08175) | - | 1696602..1697243 (-) | 642 | WP_002402487.1 | putative HNHc nuclease | - |
| M2922_RS08195 (M2922_08180) | - | 1697248..1697982 (-) | 735 | WP_002402486.1 | ERF family protein | - |
| M2922_RS08200 (M2922_08185) | - | 1697975..1698292 (-) | 318 | WP_002402485.1 | hypothetical protein | - |
| M2922_RS08205 (M2922_08190) | - | 1698488..1698826 (-) | 339 | WP_002402484.1 | hypothetical protein | - |
| M2922_RS08210 (M2922_08195) | - | 1698863..1699072 (-) | 210 | WP_002378465.1 | hypothetical protein | - |
| M2922_RS08215 (M2922_08200) | - | 1699127..1699315 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| M2922_RS08220 (M2922_08205) | - | 1699341..1700063 (-) | 723 | WP_002410531.1 | ORF6C domain-containing protein | - |
| M2922_RS08225 (M2922_08210) | - | 1700086..1700397 (-) | 312 | WP_002403885.1 | hypothetical protein | - |
| M2922_RS08230 (M2922_08215) | - | 1700409..1700600 (-) | 192 | WP_002383936.1 | hypothetical protein | - |
| M2922_RS08235 (M2922_08220) | - | 1700896..1701237 (+) | 342 | WP_002387267.1 | helix-turn-helix transcriptional regulator | - |
| M2922_RS08240 (M2922_08225) | - | 1701242..1701892 (+) | 651 | WP_002387266.1 | ImmA/IrrE family metallo-endopeptidase | - |
| M2922_RS08245 (M2922_08230) | - | 1701988..1702617 (+) | 630 | WP_002410530.1 | SHOCT domain-containing protein | - |
| M2922_RS08250 (M2922_08235) | - | 1702723..1703871 (+) | 1149 | WP_002387264.1 | site-specific integrase | - |
| M2922_RS08255 (M2922_08240) | comGD | 1703908..1704342 (-) | 435 | Protein_1604 | competence type IV pilus minor pilin ComGD | - |
| M2922_RS08260 (M2922_08245) | comGC/cglC | 1704339..1704614 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=686867 M2922_RS08260 WP_002356991.1 1704339..1704614(-) (comGC/cglC) [Enterococcus faecalis strain AT49a]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=686867 M2922_RS08260 WP_002356991.1 1704339..1704614(-) (comGC/cglC) [Enterococcus faecalis strain AT49a]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |