Detailed information NTG0068671

Bioinformatically predicted

Overview

• Name: cipB
• Type: Regulator
• Locus tag: KK0981_RS02715
• Genome accession: NZ_AP017971
• Coordinates: 499232..499381 (+)
• Length: 49 a.a.
• NCBI ID: WP_001818346.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae strain KK0981
• Function: indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	498102..498491	499232..499381	flank	741

Gene organization within MGE regions

Location: 498102..499381

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
KK0981_RS12580 (KK0981_25400)	blpM	498641..498889 (+)	249	Protein_504	two-peptide bacteriocin subunit BlpM	-
KK0981_RS12795	blpN	498878..498988 (+)	111	Protein_505	two-peptide bacteriocin subunit BlpN	-
KK0981_RS02715 (KK0981_25410)	cipB	499232..499381 (+)	150	WP_001818346.1	bacteriocin-like peptide BlpO	Regulator

Sequence

Protein

• Length: 49 a.a.
• Molecular weight: 5134.91 Da
• Isoelectric Point: 3.9133

>NTDB_id=68671 KK0981_RS02715 WP_001818346.1 499232..499381(+) (cipB) [Streptococcus pneumoniae strain KK0981]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide

• Length: 150 bp

>NTDB_id=68671 KK0981_RS02715 WP_001818346.1 499232..499381(+) (cipB) [Streptococcus pneumoniae strain KK0981]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

• Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc) (6-44)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
cipB	Streptococcus mutans UA159	51.02	100	0.51