Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   KK0981_RS02715 Genome accession   NZ_AP017971
Coordinates   499232..499381 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain KK0981     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IS/Tn 498102..498491 499232..499381 flank 741


Gene organization within MGE regions


Location: 498102..499381
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KK0981_RS12580 (KK0981_25400) blpM 498641..498889 (+) 249 Protein_504 two-peptide bacteriocin subunit BlpM -
  KK0981_RS12795 blpN 498878..498988 (+) 111 Protein_505 two-peptide bacteriocin subunit BlpN -
  KK0981_RS02715 (KK0981_25410) cipB 499232..499381 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=68671 KK0981_RS02715 WP_001818346.1 499232..499381(+) (cipB) [Streptococcus pneumoniae strain KK0981]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=68671 KK0981_RS02715 WP_001818346.1 499232..499381(+) (cipB) [Streptococcus pneumoniae strain KK0981]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51


Multiple sequence alignment