Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   M1M80_RS16490 Genome accession   NZ_CP096592
Coordinates   3241842..3241982 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus inaquosorum strain A65.1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3236842..3246982
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M1M80_RS16465 (M1M80_16465) - 3237193..3237573 (-) 381 WP_019259331.1 hotdog fold thioesterase -
  M1M80_RS16470 (M1M80_16470) comA 3237592..3238235 (-) 644 Protein_3186 two-component system response regulator ComA -
  M1M80_RS16475 (M1M80_16475) comP 3238316..3240613 (-) 2298 WP_060399389.1 histidine kinase Regulator
  M1M80_RS16480 (M1M80_16480) comX 3240621..3240782 (-) 162 WP_003241045.1 competence pheromone ComX -
  M1M80_RS16485 (M1M80_16485) - 3240797..3241657 (-) 861 WP_032732270.1 polyprenyl synthetase family protein -
  M1M80_RS16490 (M1M80_16490) degQ 3241842..3241982 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  M1M80_RS16495 (M1M80_16495) - 3242162..3242329 (+) 168 WP_119914210.1 hypothetical protein -
  M1M80_RS16500 (M1M80_16500) - 3242442..3242810 (+) 369 WP_003241042.1 hypothetical protein -
  M1M80_RS16505 (M1M80_16505) pdeH 3242786..3244015 (-) 1230 WP_060399390.1 cyclic di-GMP phosphodiesterase -
  M1M80_RS16510 (M1M80_16510) - 3244153..3245625 (-) 1473 WP_060399391.1 nicotinate phosphoribosyltransferase -
  M1M80_RS16515 (M1M80_16515) - 3245641..3246192 (-) 552 WP_060399392.1 isochorismatase family cysteine hydrolase -
  M1M80_RS16520 (M1M80_16520) - 3246289..3246687 (-) 399 WP_019259337.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=682133 M1M80_RS16490 WP_003220708.1 3241842..3241982(-) (degQ) [Bacillus inaquosorum strain A65.1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=682133 M1M80_RS16490 WP_003220708.1 3241842..3241982(-) (degQ) [Bacillus inaquosorum strain A65.1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACAACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1