Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   M1M80_RS12605 Genome accession   NZ_CP096592
Coordinates   2525874..2526047 (+) Length   57 a.a.
NCBI ID   WP_003226347.1    Uniprot ID   G4NQ83
Organism   Bacillus inaquosorum strain A65.1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2520874..2531047
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M1M80_RS12590 (M1M80_12590) gcvT 2521669..2522757 (-) 1089 WP_060399011.1 glycine cleavage system aminomethyltransferase GcvT -
  M1M80_RS12595 (M1M80_12595) - 2523201..2524874 (+) 1674 WP_060399012.1 SNF2-related protein -
  M1M80_RS12600 (M1M80_12600) - 2524895..2525689 (+) 795 WP_003236936.1 YqhG family protein -
  M1M80_RS12605 (M1M80_12605) sinI 2525874..2526047 (+) 174 WP_003226347.1 anti-repressor SinI family protein Regulator
  M1M80_RS12610 (M1M80_12610) sinR 2526081..2526416 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  M1M80_RS12615 (M1M80_12615) tasA 2526511..2527296 (-) 786 WP_003236939.1 biofilm matrix protein TasA -
  M1M80_RS12620 (M1M80_12620) - 2527360..2527932 (-) 573 WP_080429111.1 signal peptidase I -
  M1M80_RS12625 (M1M80_12625) tapA 2527916..2528680 (-) 765 WP_060399014.1 amyloid fiber anchoring/assembly protein TapA -
  M1M80_RS12630 (M1M80_12630) - 2528953..2529279 (+) 327 WP_029316858.1 YqzG/YhdC family protein -
  M1M80_RS12635 (M1M80_12635) - 2529321..2529500 (-) 180 WP_003236949.1 YqzE family protein -
  M1M80_RS12640 (M1M80_12640) comGG 2529571..2529945 (-) 375 WP_060399015.1 competence type IV pilus minor pilin ComGG Machinery gene
  M1M80_RS12645 (M1M80_12645) comGF 2529946..2530329 (-) 384 WP_060399016.1 competence type IV pilus minor pilin ComGF Machinery gene
  M1M80_RS12650 (M1M80_12650) comGE 2530355..2530699 (-) 345 WP_060399017.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6632.64 Da        Isoelectric Point: 8.6596

>NTDB_id=682110 M1M80_RS12605 WP_003226347.1 2525874..2526047(+) (sinI) [Bacillus inaquosorum strain A65.1]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=682110 M1M80_RS12605 WP_003226347.1 2525874..2526047(+) (sinI) [Bacillus inaquosorum strain A65.1]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4NQ83

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

96.491

100

0.965