Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   MU858_RS21500 Genome accession   NZ_CP095874
Coordinates   4129964..4130242 (-) Length   92 a.a.
NCBI ID   WP_247998561.1    Uniprot ID   A0A8T9Z9Z9
Organism   Bacillus sp. PGP15     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 4093127..4139535 4129964..4130242 within 0


Gene organization within MGE regions


Location: 4093127..4139535
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MU858_RS21230 (MU858_21230) - 4093127..4094809 (+) 1683 WP_166688052.1 SNF2-related protein -
  MU858_RS21235 (MU858_21235) - 4094796..4095590 (+) 795 WP_048531128.1 YqhG family protein -
  MU858_RS30075 - 4095625..4095756 (-) 132 WP_048531130.1 hypothetical protein -
  MU858_RS21240 (MU858_21240) - 4095854..4096081 (-) 228 WP_000032702.1 hypothetical protein -
  MU858_RS21245 (MU858_21245) - 4096155..4096271 (+) 117 WP_071721462.1 GTP pyrophosphokinase -
  MU858_RS21250 (MU858_21250) - 4096413..4097045 (+) 633 WP_071757288.1 VC0807 family protein -
  MU858_RS21255 (MU858_21255) - 4097114..4097314 (-) 201 WP_000106081.1 YqzE family protein -
  MU858_RS21260 (MU858_21260) aroK 4097353..4097850 (-) 498 WP_048531135.1 shikimate kinase AroK -
  MU858_RS21265 (MU858_21265) - 4097969..4098619 (-) 651 WP_166688051.1 2OG-Fe(II) oxygenase -
  MU858_RS21270 (MU858_21270) comGG 4098797..4099168 (-) 372 WP_247998525.1 competence type IV pilus minor pilin ComGG -
  MU858_RS21275 (MU858_21275) - 4099165..4099500 (-) 336 WP_247998526.1 ComGF family competence protein -
  MU858_RS21280 (MU858_21280) - 4099967..4100320 (+) 354 WP_247998527.1 YolD-like family protein -
  MU858_RS21285 (MU858_21285) - 4100351..4101154 (-) 804 WP_247998528.1 GH25 family lysozyme -
  MU858_RS21290 (MU858_21290) - 4101154..4101378 (-) 225 WP_247998529.1 hypothetical protein -
  MU858_RS21295 (MU858_21295) - 4101381..4101683 (-) 303 WP_247998530.1 hypothetical protein -
  MU858_RS21300 (MU858_21300) - 4101698..4102657 (-) 960 WP_247998531.1 tyrosine-type recombinase/integrase -
  MU858_RS21305 (MU858_21305) - 4102755..4103555 (-) 801 WP_247998532.1 SGNH/GDSL hydrolase family protein -
  MU858_RS21310 (MU858_21310) - 4103631..4105964 (-) 2334 WP_247998533.1 hypothetical protein -
  MU858_RS21315 (MU858_21315) - 4106057..4106365 (-) 309 WP_247998534.1 hypothetical protein -
  MU858_RS21320 (MU858_21320) - 4106423..4108036 (-) 1614 WP_247998535.1 phage tail protein -
  MU858_RS21325 (MU858_21325) - 4108047..4108907 (-) 861 WP_247998536.1 phage tail family protein -
  MU858_RS21330 (MU858_21330) - 4108912..4113426 (-) 4515 WP_247998537.1 hypothetical protein -
  MU858_RS30080 - 4113435..4113563 (-) 129 WP_002009224.1 hypothetical protein -
  MU858_RS21335 (MU858_21335) - 4113605..4114066 (-) 462 WP_247998538.1 hypothetical protein -
  MU858_RS21340 (MU858_21340) - 4114134..4114721 (-) 588 WP_029439649.1 hypothetical protein -
  MU858_RS21345 (MU858_21345) - 4114723..4115151 (-) 429 WP_247998539.1 hypothetical protein -
  MU858_RS21350 (MU858_21350) - 4115138..4115539 (-) 402 WP_247998540.1 hypothetical protein -
  MU858_RS21355 (MU858_21355) - 4115532..4115888 (-) 357 WP_098142341.1 phage head-tail adapter protein -
  MU858_RS21360 (MU858_21360) - 4115869..4116168 (-) 300 WP_247998541.1 phage head-tail connector protein -
  MU858_RS21365 (MU858_21365) - 4116178..4116417 (-) 240 WP_247998542.1 hypothetical protein -
  MU858_RS21370 (MU858_21370) - 4116432..4117595 (-) 1164 WP_247998543.1 phage major capsid protein -
  MU858_RS21375 (MU858_21375) - 4117637..4118350 (-) 714 WP_247998544.1 head maturation protease, ClpP-related -
  MU858_RS21380 (MU858_21380) - 4118331..4119503 (-) 1173 WP_247998545.1 phage portal protein -
  MU858_RS21385 (MU858_21385) - 4119518..4121200 (-) 1683 WP_242226078.1 terminase TerL endonuclease subunit -
  MU858_RS21390 (MU858_21390) - 4121184..4121504 (-) 321 WP_242226079.1 P27 family phage terminase small subunit -
  MU858_RS21395 (MU858_21395) - 4121612..4121920 (-) 309 WP_247998546.1 hypothetical protein -
  MU858_RS21400 (MU858_21400) - 4121923..4122192 (-) 270 WP_247998547.1 HNH endonuclease -
  MU858_RS21405 (MU858_21405) - 4122231..4122482 (-) 252 WP_247998548.1 hypothetical protein -
  MU858_RS21410 (MU858_21410) - 4122487..4122711 (-) 225 WP_247998549.1 hypothetical protein -
  MU858_RS21415 (MU858_21415) - 4122702..4122875 (-) 174 WP_247998550.1 hypothetical protein -
  MU858_RS21420 (MU858_21420) - 4123491..4124033 (-) 543 WP_001028518.1 tyrosine-type recombinase/integrase -
  MU858_RS21425 (MU858_21425) - 4124030..4124500 (-) 471 WP_147790877.1 ArpU family phage packaging/lysis transcriptional regulator -
  MU858_RS21430 (MU858_21430) - 4124521..4124691 (-) 171 WP_179958008.1 hypothetical protein -
  MU858_RS21435 (MU858_21435) - 4124807..4124929 (-) 123 WP_072192226.1 DUF3983 domain-containing protein -
  MU858_RS21440 (MU858_21440) - 4124971..4125270 (-) 300 WP_247998551.1 hypothetical protein -
  MU858_RS21445 (MU858_21445) - 4125261..4125473 (-) 213 WP_247998552.1 hypothetical protein -
  MU858_RS21450 (MU858_21450) - 4125506..4125757 (-) 252 WP_247998553.1 hypothetical protein -
  MU858_RS21455 (MU858_21455) - 4125863..4126036 (-) 174 WP_247998554.1 hypothetical protein -
  MU858_RS21460 (MU858_21460) - 4126313..4126537 (-) 225 WP_247998555.1 hypothetical protein -
  MU858_RS21465 (MU858_21465) - 4126571..4126753 (-) 183 WP_348774261.1 hypothetical protein -
  MU858_RS21470 (MU858_21470) - 4127650..4128027 (+) 378 WP_247998557.1 YxeA family protein -
  MU858_RS21475 (MU858_21475) - 4128168..4128578 (-) 411 WP_247998558.1 hypothetical protein -
  MU858_RS21480 (MU858_21480) - 4128619..4129128 (-) 510 WP_247998559.1 dUTP diphosphatase -
  MU858_RS21485 (MU858_21485) - 4129148..4129399 (-) 252 WP_074565272.1 helix-turn-helix domain containing protein -
  MU858_RS21490 (MU858_21490) - 4129425..4129592 (-) 168 WP_000717825.1 DUF3954 domain-containing protein -
  MU858_RS21495 (MU858_21495) - 4129612..4129971 (-) 360 WP_247998560.1 cell division protein SepF -
  MU858_RS21500 (MU858_21500) abrB 4129964..4130242 (-) 279 WP_247998561.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  MU858_RS21505 (MU858_21505) - 4130259..4130453 (-) 195 WP_247998562.1 hypothetical protein -
  MU858_RS21510 (MU858_21510) - 4130469..4131344 (-) 876 WP_247998563.1 ATP-binding protein -
  MU858_RS21515 (MU858_21515) - 4131283..4132170 (-) 888 WP_247998564.1 DnaD domain protein -
  MU858_RS21520 (MU858_21520) - 4132177..4132353 (-) 177 WP_098142304.1 hypothetical protein -
  MU858_RS21525 (MU858_21525) - 4132382..4132546 (-) 165 WP_098142303.1 hypothetical protein -
  MU858_RS21530 (MU858_21530) - 4132559..4132819 (-) 261 WP_098142302.1 group-specific protein -
  MU858_RS21535 (MU858_21535) - 4132859..4133590 (-) 732 WP_247998565.1 ORF6C domain-containing protein -
  MU858_RS21540 (MU858_21540) - 4133654..4133854 (-) 201 WP_098609505.1 helix-turn-helix transcriptional regulator -
  MU858_RS21545 (MU858_21545) - 4134064..4134414 (+) 351 WP_247998566.1 helix-turn-helix transcriptional regulator -
  MU858_RS21550 (MU858_21550) - 4134420..4134569 (-) 150 WP_247998567.1 hypothetical protein -
  MU858_RS21555 (MU858_21555) - 4134716..4134868 (-) 153 WP_247998568.1 hypothetical protein -
  MU858_RS21560 (MU858_21560) - 4134903..4136030 (-) 1128 WP_247998569.1 AimR family lysis-lysogeny pheromone receptor -
  MU858_RS21565 (MU858_21565) - 4136528..4136875 (+) 348 WP_074604257.1 helix-turn-helix transcriptional regulator -
  MU858_RS21570 (MU858_21570) - 4137070..4137600 (+) 531 WP_247998570.1 DUF4352 domain-containing protein -
  MU858_RS21575 (MU858_21575) - 4137613..4137957 (+) 345 WP_087964418.1 DUF4064 domain-containing protein -
  MU858_RS30085 - 4138070..4138195 (-) 126 WP_282189809.1 hypothetical protein -
  MU858_RS21580 (MU858_21580) - 4138366..4139535 (+) 1170 WP_247998571.1 site-specific integrase -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10144.76 Da        Isoelectric Point: 6.4658

>NTDB_id=679013 MU858_RS21500 WP_247998561.1 4129964..4130242(-) (abrB) [Bacillus sp. PGP15]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALGFHVEGENIILRKQEKSCFVTGEVSDSNMELLDGRMFLSKDGASEL
LYLLEKSVKVHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=679013 MU858_RS21500 WP_247998561.1 4129964..4130242(-) (abrB) [Bacillus sp. PGP15]
ATGAAAAATACGGGTGTTGCAAGAAAAGTGGATGAGCTAGGGCGTGTAGTAATTCCGGTAGAGTTACGCAGAACTTTAGG
GATTGCTGAAGGAACAGCATTAGGCTTTCATGTTGAAGGGGAAAACATCATTTTAAGAAAACAAGAAAAGTCATGTTTTG
TAACGGGTGAAGTTTCTGATTCAAACATGGAATTGCTGGATGGTCGAATGTTTTTGAGCAAGGATGGTGCGAGTGAGTTA
TTGTACCTTCTTGAAAAGAGCGTGAAGGTACATGCCTAA

Domains

Predicted by InterproScan.

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-49)

AbrB C-terminal domain (AbrB_C)

(52-85)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

60.241

90.217

0.543