Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | MYE78_RS14740 | Genome accession | NZ_CP095842 |
| Coordinates | 2998376..2998516 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain EM-1 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2993376..3003516
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MYE78_RS14715 | - | 2993722..2994105 (-) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
| MYE78_RS14720 | comA | 2994127..2994771 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| MYE78_RS14725 | comP | 2994852..2997152 (-) | 2301 | WP_032876801.1 | histidine kinase | Regulator |
| MYE78_RS14730 | comX | 2997166..2997339 (-) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| MYE78_RS14735 | - | 2997308..2998168 (-) | 861 | WP_142925231.1 | polyprenyl synthetase family protein | - |
| MYE78_RS14740 | degQ | 2998376..2998516 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| MYE78_RS14745 | - | 2998982..2999323 (+) | 342 | WP_032876795.1 | hypothetical protein | - |
| MYE78_RS14750 | - | 2999330..3000553 (-) | 1224 | WP_032876792.1 | EAL and HDOD domain-containing protein | - |
| MYE78_RS14755 | - | 3000683..3002149 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| MYE78_RS14760 | - | 3002167..3002718 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| MYE78_RS14765 | - | 3002815..3003213 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=678770 MYE78_RS14740 WP_003152043.1 2998376..2998516(-) (degQ) [Bacillus velezensis strain EM-1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=678770 MYE78_RS14740 WP_003152043.1 2998376..2998516(-) (degQ) [Bacillus velezensis strain EM-1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |