Detailed information    

insolico Bioinformatically predicted

Overview


Name   abrB   Type   Regulator
Locus tag   MW696_RS11330 Genome accession   NZ_CP095476
Coordinates   2207916..2208200 (-) Length   94 a.a.
NCBI ID   WP_048354936.1    Uniprot ID   A0A0J6EHE8
Organism   Bacillus glycinifermentans strain MGMM1     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2204345..2213061 2207916..2208200 within 0


Gene organization within MGE regions


Location: 2204345..2213061
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MW696_RS11315 (MW696_11320) rnr 2204345..2206648 (-) 2304 WP_247069392.1 ribonuclease R -
  MW696_RS11320 (MW696_11325) - 2206662..2207408 (-) 747 WP_048354929.1 carboxylesterase -
  MW696_RS11325 (MW696_11330) secG 2207526..2207756 (-) 231 WP_048354930.1 preprotein translocase subunit SecG -
  MW696_RS11330 (MW696_11335) abrB 2207916..2208200 (-) 285 WP_048354936.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  MW696_RS11335 (MW696_11340) - 2208230..2208415 (-) 186 WP_096892181.1 helix-turn-helix transcriptional regulator -
  MW696_RS11340 (MW696_11345) - 2208616..2209020 (+) 405 WP_048354931.1 transcriptional regulator -
  MW696_RS11345 (MW696_11350) - 2209176..2209574 (+) 399 WP_048354937.1 helix-turn-helix transcriptional regulator -
  MW696_RS11350 (MW696_11355) - 2209623..2210300 (-) 678 WP_048354932.1 ABC transporter permease -
  MW696_RS11355 (MW696_11360) opuCC 2210322..2211239 (-) 918 WP_048354933.1 osmoprotectant ABC transporter substrate-binding lipoprotein OpuCC -
  MW696_RS11360 (MW696_11365) - 2211253..2211906 (-) 654 WP_048354934.1 ABC transporter permease -
  MW696_RS11365 (MW696_11370) - 2211919..2213061 (-) 1143 WP_048354935.1 betaine/proline/choline family ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10469.31 Da        Isoelectric Point: 6.3369

>NTDB_id=677162 MW696_RS11330 WP_048354936.1 2207916..2208200(-) (abrB) [Bacillus glycinifermentans strain MGMM1]
MKNTGIVRRIDELGRVVLPVEMRKVLNIEEKDPLEIYSDGDSIILTKYAANMACLMTGEITTQNRAYAGGKIVLSPRGAE
LLLEDMMEALSKKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=677162 MW696_RS11330 WP_048354936.1 2207916..2208200(-) (abrB) [Bacillus glycinifermentans strain MGMM1]
GTGAAAAATACCGGAATCGTAAGGAGAATCGACGAGCTTGGAAGGGTGGTCCTCCCGGTTGAAATGCGCAAGGTGCTGAA
TATTGAGGAAAAGGACCCGCTTGAAATATACAGCGACGGAGACAGCATCATTCTCACGAAGTACGCTGCCAACATGGCAT
GTCTGATGACAGGAGAAATCACGACGCAGAACAGAGCGTACGCCGGCGGCAAAATCGTGCTCAGCCCGCGTGGTGCAGAG
CTGCTTTTGGAAGACATGATGGAGGCGCTGTCGAAAAAGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0J6EHE8

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

54.255

100

0.543