Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MW696_RS06060 Genome accession   NZ_CP095476
Coordinates   1222980..1223156 (+) Length   58 a.a.
NCBI ID   WP_247072455.1    Uniprot ID   -
Organism   Bacillus glycinifermentans strain MGMM1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1217980..1228156
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MW696_RS06045 (MW696_06045) gcvT 1218655..1219749 (-) 1095 WP_247072453.1 glycine cleavage system aminomethyltransferase GcvT -
  MW696_RS06050 (MW696_06050) - 1220329..1221996 (+) 1668 WP_057957444.1 SNF2-related protein -
  MW696_RS06055 (MW696_06055) - 1222000..1222794 (+) 795 WP_247072454.1 YqhG family protein -
  MW696_RS06060 (MW696_06060) sinI 1222980..1223156 (+) 177 WP_247072455.1 anti-repressor SinI family protein Regulator
  MW696_RS06065 (MW696_06065) sinR 1223190..1223525 (+) 336 WP_096891855.1 transcriptional regulator SinR Regulator
  MW696_RS06070 (MW696_06070) - 1223630..1224424 (-) 795 WP_048405792.1 TasA family protein -
  MW696_RS06075 (MW696_06075) - 1224492..1225073 (-) 582 WP_048405793.1 signal peptidase I -
  MW696_RS06080 (MW696_06080) tapA 1225070..1225795 (-) 726 WP_247072456.1 amyloid fiber anchoring/assembly protein TapA -
  MW696_RS06085 (MW696_06085) - 1226062..1226385 (+) 324 WP_048405795.1 DUF3889 domain-containing protein -
  MW696_RS06090 (MW696_06090) - 1226470..1226652 (-) 183 WP_046129968.1 YqzE family protein -
  MW696_RS06095 (MW696_06095) comGG 1226735..1227100 (-) 366 WP_247072457.1 competence type IV pilus minor pilin ComGG -
  MW696_RS06100 (MW696_06100) comGF 1227112..1227597 (-) 486 WP_082142393.1 competence type IV pilus minor pilin ComGF -
  MW696_RS06105 (MW696_06105) comGE 1227512..1227859 (-) 348 WP_247072458.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6738.50 Da        Isoelectric Point: 4.4865

>NTDB_id=677140 MW696_RS06060 WP_247072455.1 1222980..1223156(+) (sinI) [Bacillus glycinifermentans strain MGMM1]
MNKEDHEKEELDKEWEELIKSALNEGISPEEIRIFLNLGNKTSEASTPIERSHSIKPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=677140 MW696_RS06060 WP_247072455.1 1222980..1223156(+) (sinI) [Bacillus glycinifermentans strain MGMM1]
ATGAATAAAGAGGACCACGAGAAAGAAGAATTGGACAAGGAGTGGGAAGAGCTGATCAAAAGTGCTCTCAATGAGGGCAT
TAGTCCGGAAGAAATAAGAATTTTTCTCAATTTAGGAAATAAGACTTCCGAAGCTTCCACACCAATTGAAAGAAGTCATT
CAATAAAACCCTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

48.276

100

0.483