Detailed information    

insolico Bioinformatically predicted

Overview


Name   agrA   Type   Regulator
Locus tag   MUA12_RS09030 Genome accession   NZ_CP095104
Coordinates   1764617..1765333 (+) Length   238 a.a.
NCBI ID   WP_002481723.1    Uniprot ID   -
Organism   Staphylococcus simulans strain IVB6179     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1743040..1769835 1764617..1765333 within 0


Gene organization within MGE regions


Location: 1743040..1769835
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MUA12_RS08900 (MUA12_08855) - 1743040..1743273 (-) 234 WP_262577110.1 hypothetical protein -
  MUA12_RS08905 (MUA12_08860) - 1743368..1743676 (-) 309 WP_262577111.1 phage head closure protein -
  MUA12_RS08910 (MUA12_08865) - 1743736..1745379 (-) 1644 WP_262577113.1 terminase large subunit -
  MUA12_RS08915 (MUA12_08870) - 1745372..1745692 (-) 321 WP_262577114.1 hypothetical protein -
  MUA12_RS08920 (MUA12_08875) - 1746114..1746395 (-) 282 WP_262577115.1 head-tail connector protein -
  MUA12_RS08925 (MUA12_08880) - 1746574..1747800 (-) 1227 WP_262577116.1 phage major capsid protein -
  MUA12_RS08930 (MUA12_08885) - 1747802..1748368 (-) 567 WP_262577117.1 HK97 family phage prohead protease -
  MUA12_RS08935 (MUA12_08890) - 1748355..1749557 (-) 1203 WP_262557900.1 phage portal protein -
  MUA12_RS08940 (MUA12_08895) - 1750241..1751911 (-) 1671 WP_262577119.1 DUF927 domain-containing protein -
  MUA12_RS08945 (MUA12_08900) - 1751916..1752773 (-) 858 WP_262577120.1 primase alpha helix C-terminal domain-containing protein -
  MUA12_RS08950 (MUA12_08905) - 1752856..1753116 (-) 261 WP_262577121.1 hypothetical protein -
  MUA12_RS08955 (MUA12_08910) - 1753116..1753538 (-) 423 WP_262577123.1 hypothetical protein -
  MUA12_RS08960 (MUA12_08915) - 1753541..1753744 (-) 204 WP_262577125.1 pathogenicity island protein -
  MUA12_RS08965 (MUA12_08920) - 1753746..1754051 (-) 306 WP_262577126.1 helix-turn-helix domain-containing protein -
  MUA12_RS08970 (MUA12_08925) - 1754055..1754267 (-) 213 WP_262577128.1 helix-turn-helix transcriptional regulator -
  MUA12_RS08975 (MUA12_08930) - 1754436..1755068 (+) 633 WP_262577129.1 helix-turn-helix transcriptional regulator -
  MUA12_RS08980 (MUA12_08935) - 1755078..1756253 (+) 1176 WP_262577131.1 site-specific integrase -
  MUA12_RS08985 (MUA12_08940) groL 1756317..1757936 (-) 1620 WP_002481715.1 chaperonin GroEL -
  MUA12_RS08990 (MUA12_08945) groES 1757975..1758259 (-) 285 WP_002481716.1 co-chaperone GroES -
  MUA12_RS08995 (MUA12_08950) mroQ 1758476..1759219 (+) 744 WP_107548248.1 intramembrane glutamic endopeptidase MroQ -
  MUA12_RS09000 (MUA12_08955) - 1759308..1760756 (-) 1449 WP_262577133.1 SdrH family protein -
  MUA12_RS09005 (MUA12_08960) - 1760977..1761777 (+) 801 WP_107548250.1 carbon-nitrogen family hydrolase -
  MUA12_RS09010 (MUA12_08965) - 1762082..1762246 (-) 165 WP_262577134.1 delta-lysin family phenol-soluble modulin -
  MUA12_RS09015 (MUA12_08970) - 1762558..1763136 (+) 579 WP_262577136.1 accessory gene regulator AgrB -
  MUA12_RS09020 (MUA12_08975) agrD 1763136..1763273 (+) 138 WP_023015908.1 cyclic lactone autoinducer peptide AgrD -
  MUA12_RS09025 (MUA12_08980) agrC 1763313..1764614 (+) 1302 WP_262577138.1 quorum-sensing sensor histidine kinase AgrC -
  MUA12_RS09030 (MUA12_08985) agrA 1764617..1765333 (+) 717 WP_002481723.1 quorum-sensing response regulator AgrA Regulator
  MUA12_RS09035 (MUA12_08990) - 1765408..1766892 (-) 1485 WP_262577139.1 glycoside hydrolase family 32 protein -
  MUA12_RS09040 (MUA12_08995) - 1767128..1768216 (+) 1089 WP_262577140.1 YeeE/YedE family protein -
  MUA12_RS09045 (MUA12_09000) - 1768272..1768496 (+) 225 WP_002481726.1 sulfurtransferase TusA family protein -

Sequence


Protein


Download         Length: 238 a.a.        Molecular weight: 27762.55 Da        Isoelectric Point: 4.6392

>NTDB_id=675473 MUA12_RS09030 WP_002481723.1 1764617..1765333(+) (agrA) [Staphylococcus simulans strain IVB6179]
MKIIICEDDVQQREHIESIIENYIMIEEKPLEVALSTGDPYEVLEFAKATNEICCYFLDIQLDSDINGIKLGSELRNYDS
VGSIIFITSHSELTYLTFVYKVAAMDFIFKDDPSEMKSRIIDCIETALTRLQLLSKESSLETIELKRGSNSVYVNYDDVM
FFESSAKSHRLIAHLDNRQIEFYGNLKDLSQLDDRFFRCHNSYVINRNNIEEVISKEREVYFKNGEHCYISVRNLKKI

Nucleotide


Download         Length: 717 bp        

>NTDB_id=675473 MUA12_RS09030 WP_002481723.1 1764617..1765333(+) (agrA) [Staphylococcus simulans strain IVB6179]
GTGAAGATTATTATATGCGAAGATGATGTACAACAGCGTGAACACATTGAATCCATCATTGAAAATTATATTATGATTGA
AGAAAAACCTTTAGAAGTGGCGCTCTCAACGGGTGATCCTTATGAGGTATTAGAATTCGCTAAAGCTACAAATGAGATTT
GTTGTTACTTCTTAGATATTCAGTTAGATTCTGATATTAACGGTATTAAGCTTGGCAGCGAACTTAGAAACTATGATTCT
GTCGGCAGTATTATCTTTATTACTAGTCACAGTGAACTCACTTATCTTACTTTCGTTTATAAAGTAGCAGCCATGGACTT
TATTTTTAAAGATGACCCTTCAGAAATGAAATCTCGAATTATTGATTGTATCGAAACTGCATTGACGAGACTACAGTTGC
TTTCAAAAGAATCTAGTCTCGAAACAATTGAGTTAAAACGTGGTAGTAACTCAGTCTATGTTAATTACGATGATGTCATG
TTCTTTGAATCCTCGGCAAAATCACATCGCTTAATTGCGCATTTAGACAATCGTCAAATCGAATTTTATGGCAACTTAAA
AGATTTAAGCCAATTAGATGACCGCTTCTTCCGTTGTCACAATAGTTACGTCATTAATCGCAATAACATCGAAGAAGTAA
TATCTAAAGAACGTGAGGTCTACTTTAAAAATGGTGAACACTGTTATATCTCAGTAAGAAATTTAAAGAAAATCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  agrA Staphylococcus aureus N315

79.412

100

0.794