Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MUU70_RS14470 Genome accession   NZ_CP095093
Coordinates   2962686..2962826 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain D103     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2957686..2967826
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MUU70_RS14445 (MUU70_14435) - 2958026..2958409 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  MUU70_RS14450 (MUU70_14440) comA 2958431..2959075 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  MUU70_RS14455 (MUU70_14445) comP 2959156..2961447 (-) 2292 WP_094247540.1 histidine kinase Regulator
  MUU70_RS14460 (MUU70_14450) comX 2961459..2961623 (-) 165 WP_007613432.1 competence pheromone ComX -
  MUU70_RS14465 (MUU70_14455) - 2961623..2962534 (-) 912 WP_031378407.1 polyprenyl synthetase family protein -
  MUU70_RS14470 (MUU70_14460) degQ 2962686..2962826 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  MUU70_RS14475 (MUU70_14465) - 2963291..2963632 (+) 342 WP_014305721.1 hypothetical protein -
  MUU70_RS14480 (MUU70_14470) - 2963639..2964859 (-) 1221 WP_070082287.1 EAL and HDOD domain-containing protein -
  MUU70_RS14485 (MUU70_14475) - 2964989..2966455 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  MUU70_RS14490 (MUU70_14480) - 2966473..2967024 (-) 552 WP_025853916.1 cysteine hydrolase family protein -
  MUU70_RS14495 (MUU70_14485) - 2967121..2967519 (-) 399 WP_087634936.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=675337 MUU70_RS14470 WP_003152043.1 2962686..2962826(-) (degQ) [Bacillus velezensis strain D103]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=675337 MUU70_RS14470 WP_003152043.1 2962686..2962826(-) (degQ) [Bacillus velezensis strain D103]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891