Detailed information    

insolico Bioinformatically predicted

Overview


Name   qstR   Type   Regulator
Locus tag   OHA59_RS48005 Genome accession   NZ_CP109333
Coordinates   10299707..10299865 (-) Length   52 a.a.
NCBI ID   WP_406435616.1    Uniprot ID   -
Organism   Streptomyces sp. NBC_01589     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Genomic Context


Location: 10294707..10304865
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OHA59_RS47985 (OHA59_48025) - 10295533..10296114 (-) 582 WP_406424071.1 TetR/AcrR family transcriptional regulator -
  OHA59_RS47990 (OHA59_48030) - 10296471..10296920 (-) 450 WP_330242752.1 lipocalin-like domain-containing protein -
  OHA59_RS47995 (OHA59_48035) - 10297267..10297896 (+) 630 WP_267007498.1 isochorismatase family cysteine hydrolase -
  OHA59_RS48000 (OHA59_48040) - 10297898..10299475 (+) 1578 WP_406424069.1 aldehyde dehydrogenase (NADP(+)) -
  OHA59_RS48005 (OHA59_48045) qstR 10299707..10299865 (-) 159 WP_406435616.1 response regulator transcription factor Regulator
  OHA59_RS48010 (OHA59_48050) - 10299832..10301733 (-) 1902 WP_406435632.1 LuxR family transcriptional regulator -
  OHA59_RS48015 (OHA59_48055) - 10301810..10302142 (+) 333 WP_406435630.1 hypothetical protein -
  OHA59_RS48020 (OHA59_48060) - 10302050..10302484 (-) 435 Protein_9504 ATP-binding protein -
  OHA59_RS48025 (OHA59_48070) - 10302691..10303362 (-) 672 WP_406434830.1 pyridoxamine 5'-phosphate oxidase family protein -
  OHA59_RS48030 (OHA59_48075) - 10303400..10304731 (+) 1332 WP_406424067.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -

Sequence


Protein


Download         Length: 52 a.a.        Molecular weight: 5786.71 Da        Isoelectric Point: 10.4292

>NTDB_id=674458 OHA59_RS48005 WP_406435616.1 10299707..10299865(-) (qstR) [Streptomyces sp. NBC_01589]
METARLAASGLTNKQVAERLFLSHRTVGAHLYQIYPKLGITSRAMLRDALES

Nucleotide


Download         Length: 159 bp        

>NTDB_id=674458 OHA59_RS48005 WP_406435616.1 10299707..10299865(-) (qstR) [Streptomyces sp. NBC_01589]
CTGGAGACAGCCCGGCTCGCCGCCTCCGGCCTGACCAACAAGCAGGTAGCGGAGCGTCTGTTCCTCTCCCACCGGACTGT
CGGCGCCCATCTCTACCAGATTTACCCGAAGTTGGGCATCACGTCCCGTGCCATGCTGCGAGACGCCCTGGAATCCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  qstR Vibrio cholerae strain A1552

43.182

84.615

0.365