Detailed information    

insolico Bioinformatically predicted

Overview

Name   sepM   Type   Regulator
Locus tag   MUB28_RS07720 Genome accession   NZ_CP094945
Coordinates   1502651..1503727 (-) Length   358 a.a.
NCBI ID   WP_011681549.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain VHProbi R08     
Function   processing of CSP (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1497335..1566903 1502651..1503727 within 0


Gene organization within MGE regions


Location: 1497335..1566903
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MUB28_RS07695 (MUB28_07695) - 1497359..1498141 (+) 783 WP_011226459.1 ABC transporter ATP-binding protein -
  MUB28_RS07700 (MUB28_07700) - 1498763..1500829 (-) 2067 WP_011681548.1 sodium:proton antiporter -
  MUB28_RS07705 (MUB28_07705) - 1500838..1501080 (-) 243 WP_011226461.1 hypothetical protein -
  MUB28_RS07710 (MUB28_07710) - 1501077..1501625 (-) 549 WP_011226462.1 class I SAM-dependent methyltransferase -
  MUB28_RS07715 (MUB28_07715) - 1501622..1502566 (-) 945 WP_011226463.1 TIGR01212 family radical SAM protein -
  MUB28_RS07720 (MUB28_07720) sepM 1502651..1503727 (-) 1077 WP_011681549.1 SepM family pheromone-processing serine protease Regulator
  MUB28_RS07725 (MUB28_07725) coaD 1503705..1504202 (-) 498 WP_011681550.1 pantetheine-phosphate adenylyltransferase -
  MUB28_RS07730 (MUB28_07730) rsmD 1504236..1504835 (-) 600 Protein_1487 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  MUB28_RS07735 (MUB28_07735) trxB 1504926..1505879 (-) 954 WP_255136104.1 thioredoxin-disulfide reductase -
  MUB28_RS07740 (MUB28_07740) - 1505912..1506136 (-) 225 WP_014621911.1 DUF4059 family protein -
  MUB28_RS07745 (MUB28_07745) - 1506351..1507094 (-) 744 WP_014608652.1 amino acid ABC transporter ATP-binding protein -
  MUB28_RS07750 (MUB28_07750) - 1507094..1507840 (-) 747 WP_095559509.1 amino acid ABC transporter permease -
  MUB28_RS07755 (MUB28_07755) - 1508236..1509066 (-) 831 WP_014727671.1 transporter substrate-binding domain-containing protein -
  MUB28_RS07760 (MUB28_07760) - 1509526..1509759 (-) 234 WP_002947030.1 hypothetical protein -
  MUB28_RS07765 (MUB28_07765) dinB 1510057..1511160 (-) 1104 WP_014608654.1 DNA polymerase IV -
  MUB28_RS07770 (MUB28_07770) pflB 1511439..1513748 (+) 2310 WP_011226473.1 formate C-acetyltransferase -
  MUB28_RS07775 (MUB28_07775) - 1514015..1514797 (+) 783 WP_014727672.1 carbonic anhydrase family protein -
  MUB28_RS07780 (MUB28_07780) - 1514848..1515300 (+) 453 WP_014608655.1 GNAT family N-acetyltransferase -
  MUB28_RS07785 (MUB28_07785) - 1515651..1515956 (-) 306 WP_014621914.1 restriction endonuclease subunit S -
  MUB28_RS09765 mobV 1515981..1516489 (-) 509 Protein_1499 MobV family relaxase -
  MUB28_RS07795 (MUB28_07795) fetB 1516934..1517689 (-) 756 WP_011681558.1 iron export ABC transporter permease subunit FetB -
  MUB28_RS07800 (MUB28_07800) - 1517686..1518336 (-) 651 WP_011681559.1 ATP-binding cassette domain-containing protein -
  MUB28_RS07805 (MUB28_07805) - 1518539..1519495 (-) 957 WP_002951776.1 serine hydrolase domain-containing protein -
  MUB28_RS07810 (MUB28_07810) - 1519495..1520250 (-) 756 WP_011681560.1 CppA family protein -
  MUB28_RS07815 (MUB28_07815) - 1520532..1520894 (+) 363 WP_014608659.1 CPBP family intramembrane glutamic endopeptidase -
  MUB28_RS07820 (MUB28_07820) gla 1520981..1521844 (-) 864 WP_002951781.1 aquaglyceroporin Gla -
  MUB28_RS07825 (MUB28_07825) - 1521965..1524232 (+) 2268 WP_011681561.1 Xaa-Pro dipeptidyl-peptidase -
  MUB28_RS07830 (MUB28_07830) - 1524312..1524692 (-) 381 WP_002951783.1 hypothetical protein -
  MUB28_RS07835 (MUB28_07835) - 1524817..1525080 (-) 264 WP_002945924.1 hypothetical protein -
  MUB28_RS07840 (MUB28_07840) - 1525402..1525698 (-) 297 WP_004197070.1 bacteriocin immunity protein -
  MUB28_RS07845 (MUB28_07845) - 1525863..1526069 (-) 207 WP_011681562.1 hypothetical protein -
  MUB28_RS07850 (MUB28_07850) - 1526100..1526789 (-) 690 WP_011681563.1 thioredoxin family protein -
  MUB28_RS07855 (MUB28_07855) - 1526983..1528553 (+) 1571 WP_087009847.1 IS3-like element ISSth1b family transposase -
  MUB28_RS07860 (MUB28_07860) - 1528699..1528953 (-) 255 WP_014608660.1 Blp family class II bacteriocin -
  MUB28_RS09770 - 1529204..1529605 (-) 402 WP_024703992.1 hypothetical protein -
  MUB28_RS07865 (MUB28_07865) - 1530610..1530840 (-) 231 WP_014608662.1 bacteriocin class II family protein -
  MUB28_RS07870 (MUB28_07870) - 1531196..1531396 (-) 201 WP_011681569.1 hypothetical protein -
  MUB28_RS07875 (MUB28_07875) - 1531415..1531591 (-) 177 WP_011681570.1 Blp family class II bacteriocin -
  MUB28_RS07880 (MUB28_07880) - 1531842..1532579 (+) 738 WP_011681571.1 response regulator transcription factor -
  MUB28_RS07885 (MUB28_07885) - 1533110..1533913 (+) 804 WP_224102945.1 ATP-binding protein -
  MUB28_RS07890 (MUB28_07890) - 1533931..1534092 (-) 162 WP_011681573.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  MUB28_RS07895 (MUB28_07895) - 1534107..1535474 (-) 1368 WP_011681574.1 bacteriocin secretion accessory protein -
  MUB28_RS07900 (MUB28_07900) comA/nlmT 1535490..1537643 (-) 2154 WP_014727675.1 peptide cleavage/export ABC transporter Regulator
  MUB28_RS07905 (MUB28_07905) - 1538723..1540468 (-) 1746 WP_014727676.1 ABC transporter ATP-binding protein -
  MUB28_RS07910 (MUB28_07910) - 1540461..1542098 (-) 1638 WP_014727677.1 ABC transporter transmembrane domain-containing protein -
  MUB28_RS07915 (MUB28_07915) - 1542407..1542613 (-) 207 WP_002948879.1 hypothetical protein -
  MUB28_RS07920 (MUB28_07920) - 1542818..1543345 (-) 528 WP_014621925.1 VanZ family protein -
  MUB28_RS07925 (MUB28_07925) rlmN 1543347..1544456 (-) 1110 WP_100285012.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  MUB28_RS07930 (MUB28_07930) - 1544520..1545242 (-) 723 WP_011681580.1 YutD family protein -
  MUB28_RS07935 (MUB28_07935) - 1545297..1546652 (-) 1356 WP_014727679.1 metallophosphatase -
  MUB28_RS09650 - 1546931..1547062 (-) 132 WP_258380174.1 hypothetical protein -
  MUB28_RS07940 (MUB28_07940) - 1547501..1548844 (-) 1344 WP_002948888.1 DEAD/DEAH box helicase -
  MUB28_RS07945 (MUB28_07945) mraY 1548919..1549941 (-) 1023 WP_011227524.1 phospho-N-acetylmuramoyl-pentapeptide- transferase -
  MUB28_RS07950 (MUB28_07950) pbp2X 1549943..1552210 (-) 2268 WP_041829325.1 penicillin-binding protein PBP2X -
  MUB28_RS07955 (MUB28_07955) ftsL 1552214..1552534 (-) 321 WP_014727681.1 cell division protein FtsL -
  MUB28_RS07960 (MUB28_07960) rsmH 1552537..1553487 (-) 951 WP_014727682.1 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH -
  MUB28_RS07965 (MUB28_07965) - 1553602..1554300 (-) 699 WP_014727683.1 hypothetical protein -
  MUB28_RS07970 (MUB28_07970) - 1554258..1554644 (-) 387 WP_014727684.1 hypothetical protein -
  MUB28_RS07975 (MUB28_07975) - 1554761..1555009 (-) 249 WP_224102941.1 Wzz/FepE/Etk N-terminal domain-containing protein -
  MUB28_RS07980 (MUB28_07980) - 1555283..1555639 (-) 357 WP_014621938.1 DUF805 domain-containing protein -
  MUB28_RS07985 (MUB28_07985) - 1555988..1556155 (-) 168 WP_153300736.1 hypothetical protein -
  MUB28_RS07990 (MUB28_07990) - 1556488..1557738 (-) 1251 WP_014608675.1 glutamate-5-semialdehyde dehydrogenase -
  MUB28_RS07995 (MUB28_07995) proB 1557740..1558543 (-) 804 WP_014608676.1 glutamate 5-kinase -
  MUB28_RS08000 (MUB28_08000) - 1558664..1560253 (-) 1590 WP_014608677.1 ABC transporter permease -
  MUB28_RS08005 (MUB28_08005) - 1560256..1560987 (-) 732 WP_014727686.1 ABC transporter ATP-binding protein -
  MUB28_RS08010 (MUB28_08010) - 1561262..1561993 (+) 732 WP_014608678.1 DUF554 domain-containing protein -
  MUB28_RS08015 (MUB28_08015) addA 1562345..1565998 (-) 3654 WP_014727687.1 helicase-exonuclease AddAB subunit AddA -

Sequence

Protein


Download         Length: 358 a.a.        Molecular weight: 39172.02 Da        Isoelectric Point: 9.3888

>NTDB_id=674425 MUB28_RS07720 WP_011681549.1 1502651..1503727(-) (sepM) [Streptococcus thermophilus strain VHProbi R08]
MANKTKSKALLEKMWRIKWWLLSIFTVLFLLFALFFPLNNYYVELPGGAFDTKEVLTVNKKADDSKGSYNFVAVAQTKAT
LALMLYAQFNDFAKLQTAEEATGNYSDEDFMRINQFYMETSQNQAVYQGLTLAGKEVSLEYMGVYVLQVADDSSFKGVLN
IADTVTAVNGNTFDNSTDMIKYVQGLKLGSKVKVTYMRDGKEKTATGKIIKIANGKNGIGIGLTDHTEIKSPENVKFKLD
GVGGPSAGLMFTLAIYDQVSGQDLKAGRKIAGTGTIEKDGAVGDIGGAYLKVKSAADSGADIFFVPNNLVTKEMKKADPD
AKTNYQEAKEAAEKLGTKMKIVPVKTAQEAIDYLKKTK

Nucleotide


Download         Length: 1077 bp        

>NTDB_id=674425 MUB28_RS07720 WP_011681549.1 1502651..1503727(-) (sepM) [Streptococcus thermophilus strain VHProbi R08]
GTGGCAAACAAGACAAAATCTAAAGCGCTATTAGAGAAAATGTGGCGTATTAAGTGGTGGTTATTAAGTATTTTTACGGT
ACTTTTCCTCCTTTTTGCCCTCTTTTTCCCGCTCAATAATTACTATGTGGAGCTTCCGGGTGGTGCTTTTGATACCAAGG
AAGTCTTGACAGTGAATAAGAAAGCTGATGATTCTAAGGGCTCCTATAATTTTGTGGCGGTGGCTCAAACCAAGGCGACT
TTGGCCTTGATGCTCTATGCTCAGTTTAATGATTTTGCAAAGCTTCAAACGGCTGAAGAGGCAACTGGAAATTACTCTGA
TGAAGATTTCATGCGCATCAACCAATTTTACATGGAGACTTCTCAAAACCAAGCGGTTTATCAGGGCTTGACTCTGGCTG
GTAAGGAGGTTAGTTTGGAGTATATGGGTGTCTATGTGCTTCAGGTTGCTGATGATTCTAGCTTCAAGGGTGTCCTCAAT
ATTGCTGATACGGTGACGGCTGTTAATGGTAATACCTTTGATAATTCTACTGACATGATTAAATACGTTCAAGGACTTAA
GCTGGGTTCAAAGGTCAAGGTCACTTATATGAGAGATGGCAAAGAAAAGACTGCTACTGGTAAGATTATTAAGATTGCCA
ATGGCAAAAATGGTATTGGTATCGGCCTAACGGACCATACTGAGATCAAGAGTCCTGAGAATGTTAAGTTTAAACTGGAT
GGTGTCGGTGGGCCAAGTGCTGGTCTTATGTTTACCTTGGCTATTTACGATCAGGTGTCTGGTCAAGACCTCAAGGCTGG
CCGCAAGATTGCTGGTACAGGAACTATTGAAAAAGATGGGGCTGTCGGTGATATCGGTGGGGCCTATCTCAAGGTGAAAT
CTGCGGCTGATAGTGGCGCAGACATTTTCTTCGTGCCAAATAATCTAGTAACTAAGGAAATGAAAAAGGCTGATCCGGAT
GCCAAGACTAATTATCAAGAGGCCAAGGAAGCTGCCGAGAAACTGGGGACCAAGATGAAAATCGTCCCTGTTAAAACAGC
TCAAGAAGCCATTGATTATTTGAAAAAGACTAAATGA

Domains

Predicted by InterproScan.

PDZ domain (PDZ_2)

(137-206)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sepM Streptococcus mutans UA159

62.757

95.251

0.598