Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   MUB47_RS11655 Genome accession   NZ_CP094930
Coordinates   2435502..2435675 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain GUIA     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2430502..2440675
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MUB47_RS11640 (MUB47_11640) gcvT 2431316..2432416 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  MUB47_RS11645 (MUB47_11645) - 2432839..2434509 (+) 1671 WP_032874031.1 SNF2-related protein -
  MUB47_RS11650 (MUB47_11650) - 2434531..2435325 (+) 795 WP_007612541.1 YqhG family protein -
  MUB47_RS11655 (MUB47_11655) sinI 2435502..2435675 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  MUB47_RS11660 (MUB47_11660) sinR 2435709..2436044 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MUB47_RS11665 (MUB47_11665) - 2436092..2436877 (-) 786 WP_032874027.1 TasA family protein -
  MUB47_RS11670 (MUB47_11670) - 2436942..2437526 (-) 585 WP_032874025.1 signal peptidase I -
  MUB47_RS11675 (MUB47_11675) tapA 2437498..2438169 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  MUB47_RS11680 (MUB47_11680) - 2438428..2438757 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  MUB47_RS11685 (MUB47_11685) - 2438798..2438977 (-) 180 WP_022552966.1 YqzE family protein -
  MUB47_RS11690 (MUB47_11690) comGG 2439034..2439411 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  MUB47_RS11695 (MUB47_11695) comGF 2439412..2439876 (-) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  MUB47_RS11700 (MUB47_11700) comGE 2439821..2440135 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  MUB47_RS11705 (MUB47_11705) comGD 2440119..2440556 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=674264 MUB47_RS11655 WP_032874029.1 2435502..2435675(+) (sinI) [Bacillus velezensis strain GUIA]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=674264 MUB47_RS11655 WP_032874029.1 2435502..2435675(+) (sinI) [Bacillus velezensis strain GUIA]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719