Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BTUAT1_RS14695 Genome accession   NZ_AP014928
Coordinates   2867335..2867475 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain TUAT1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2862335..2872475
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BTUAT1_RS14675 (BTUAT1_29120) - 2862614..2863003 (-) 390 WP_017358943.1 hotdog fold thioesterase -
  BTUAT1_RS14680 (BTUAT1_29130) comA 2863027..2863668 (-) 642 WP_060832600.1 response regulator transcription factor Regulator
  BTUAT1_RS14685 (BTUAT1_29140) comP 2863749..2866061 (-) 2313 WP_035701206.1 ATP-binding protein Regulator
  BTUAT1_RS19350 (BTUAT1_29150) comX 2866102..2866272 (-) 171 WP_074041927.1 competence pheromone ComX -
  BTUAT1_RS14690 (BTUAT1_29160) - 2866269..2867183 (-) 915 WP_060832601.1 polyprenyl synthetase family protein -
  BTUAT1_RS14695 (BTUAT1_29170) degQ 2867335..2867475 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  BTUAT1_RS14700 (BTUAT1_29180) - 2867981..2868334 (+) 354 WP_019744042.1 hypothetical protein -
  BTUAT1_RS14705 (BTUAT1_29190) - 2868371..2869597 (-) 1227 WP_035701209.1 EAL and HDOD domain-containing protein -
  BTUAT1_RS14710 (BTUAT1_29200) - 2869738..2871207 (-) 1470 WP_017358937.1 nicotinate phosphoribosyltransferase -
  BTUAT1_RS14715 (BTUAT1_29210) - 2871225..2871776 (-) 552 WP_008345872.1 cysteine hydrolase family protein -
  BTUAT1_RS14720 (BTUAT1_29220) - 2871837..2872244 (-) 408 WP_007500468.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=67404 BTUAT1_RS14695 WP_003213123.1 2867335..2867475(-) (degQ) [Bacillus altitudinis strain TUAT1]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=67404 BTUAT1_RS14695 WP_003213123.1 2867335..2867475(-) (degQ) [Bacillus altitudinis strain TUAT1]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment