Detailed information NTG0672379

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: MUA10_RS08320
• Genome accession: NZ_CP094778
• Coordinates: 1693427..1693738 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472257.1
• Uniprot ID: A0A115HMG3
• Organism: Staphylococcus aureus strain IVB6185
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1688427..1698738

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MUA10_RS08285 (MUA10_08280)	gcvPA	1688929..1690275 (-)	1347	WP_250396247.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
MUA10_RS08290 (MUA10_08285)	gcvT	1690295..1691386 (-)	1092	WP_111040234.1	glycine cleavage system aminomethyltransferase GcvT	-
MUA10_RS08295 (MUA10_08290)	-	1691545..1692069 (-)	525	WP_001015125.1	shikimate kinase	-
MUA10_RS08300 (MUA10_08295)	-	1692059..1692205 (-)	147	WP_001789879.1	hypothetical protein	-
MUA10_RS08305 (MUA10_08300)	comGF	1692302..1692799 (-)	498	WP_001794328.1	competence type IV pilus minor pilin ComGF	Machinery gene
MUA10_RS08310 (MUA10_08305)	comGE	1692717..1693016 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
MUA10_RS08315 (MUA10_08310)	comGD	1693003..1693449 (-)	447	WP_001791207.1	competence type IV pilus minor pilin ComGD	Machinery gene
MUA10_RS08320 (MUA10_08315)	comGC	1693427..1693738 (-)	312	WP_000472257.1	competence type IV pilus major pilin ComGC	Machinery gene
MUA10_RS08325 (MUA10_08320)	comGB	1693752..1694822 (-)	1071	WP_250396246.1	competence type IV pilus assembly protein ComGB	Machinery gene
MUA10_RS08330 (MUA10_08325)	comGA	1694794..1695768 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
MUA10_RS08335 (MUA10_08330)	-	1695821..1696444 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
MUA10_RS08340 (MUA10_08335)	-	1696441..1696770 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
MUA10_RS08345 (MUA10_08340)	-	1696770..1697756 (-)	987	WP_000161314.1	ROK family glucokinase	-
MUA10_RS08350 (MUA10_08345)	-	1697753..1697956 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11373.39 Da
• Isoelectric Point: 7.8600

>NTDB_id=672379 MUA10_RS08320 WP_000472257.1 1693427..1693738(-) (comGC) [Staphylococcus aureus strain IVB6185]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEEQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=672379 MUA10_RS08320 WP_000472257.1 1693427..1693738(-) (comGC) [Staphylococcus aureus strain IVB6185]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGAGCAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

3D structure

• AlphaFold DB: A0A115HMG3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	99.029	100	0.99
comGC	Staphylococcus aureus MW2	99.029	100	0.99
comGC/cglC	Streptococcus mitis SK321	48.039	99.029	0.476
comGC/cglC	Streptococcus pneumoniae R6	47.059	99.029	0.466
comGC/cglC	Streptococcus pneumoniae D39	47.059	99.029	0.466
comGC/cglC	Streptococcus pneumoniae TIGR4	47.059	99.029	0.466
comGC/cglC	Streptococcus pneumoniae Rx1	47.059	99.029	0.466
comGC/cglC	Streptococcus mitis NCTC 12261	52.326	83.495	0.437
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comYC	Streptococcus mutans UA140	50	73.786	0.369
comYC	Streptococcus mutans UA159	50	73.786	0.369
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369