Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   MTX16_RS27060 Genome accession   NZ_CP094624
Coordinates   5297789..5298067 (+) Length   92 a.a.
NCBI ID   WP_243821008.1    Uniprot ID   -
Organism   Bacillus thuringiensis strain LX43     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 5288089..5315748 5297789..5298067 within 0


Gene organization within MGE regions


Location: 5288089..5315748
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MTX16_RS26990 tenA 5288089..5288778 (+) 690 WP_001011746.1 thiaminase II -
  MTX16_RS26995 - 5289176..5289439 (+) 264 WP_002082716.1 DUF3937 domain-containing protein -
  MTX16_RS27000 - 5289801..5290097 (+) 297 WP_142408467.1 heterocycloanthracin/sonorensin family bacteriocin -
  MTX16_RS27005 - 5290591..5291076 (+) 486 WP_002041181.1 hypothetical protein -
  MTX16_RS27010 - 5291388..5292089 (+) 702 WP_243821005.1 DUF3962 domain-containing protein -
  MTX16_RS27015 - 5292128..5293237 (-) 1110 WP_243821006.1 tyrosine-type recombinase/integrase -
  MTX16_RS27020 - 5293785..5294936 (+) 1152 WP_243821007.1 AimR family lysis-lysogeny pheromone receptor -
  MTX16_RS27025 - 5294974..5295120 (+) 147 WP_000720921.1 hypothetical protein -
  MTX16_RS27030 - 5295207..5295404 (+) 198 WP_033695148.1 hypothetical protein -
  MTX16_RS27035 - 5295442..5295795 (-) 354 WP_000491236.1 helix-turn-helix transcriptional regulator -
  MTX16_RS27040 - 5295996..5296187 (+) 192 WP_000854271.1 helix-turn-helix transcriptional regulator -
  MTX16_RS27045 - 5296242..5296508 (+) 267 WP_000522030.1 helix-turn-helix domain-containing protein -
  MTX16_RS27050 - 5296508..5296672 (+) 165 WP_080467917.1 hypothetical protein -
  MTX16_RS27055 - 5296730..5297785 (+) 1056 WP_063264025.1 DnaD domain protein -
  MTX16_RS27060 abrB 5297789..5298067 (+) 279 WP_243821008.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  MTX16_RS27065 - 5298060..5298419 (+) 360 WP_243821009.1 cell division protein SepF -
  MTX16_RS27070 - 5298438..5298605 (+) 168 WP_006923988.1 DUF3954 domain-containing protein -
  MTX16_RS27075 - 5298631..5298882 (+) 252 WP_243821010.1 helix-turn-helix domain containing protein -
  MTX16_RS27080 - 5298902..5299411 (+) 510 WP_243821011.1 dUTP diphosphatase -
  MTX16_RS27085 - 5299670..5300185 (+) 516 WP_243821012.1 hypothetical protein -
  MTX16_RS27090 - 5300182..5300604 (+) 423 WP_098311451.1 hypothetical protein -
  MTX16_RS27095 - 5302505..5303821 (+) 1317 WP_243821013.1 exosporium glycoprotein BclB-related protein -
  MTX16_RS27100 - 5304140..5304292 (+) 153 WP_243821014.1 hypothetical protein -
  MTX16_RS27105 - 5304574..5305038 (-) 465 WP_001109248.1 hypothetical protein -
  MTX16_RS27110 - 5305230..5305961 (-) 732 WP_000546546.1 hypothetical protein -
  MTX16_RS27115 - 5306204..5306668 (-) 465 WP_000796385.1 hypothetical protein -
  MTX16_RS27120 - 5308016..5308171 (+) 156 WP_243821015.1 hypothetical protein -
  MTX16_RS27125 - 5308911..5309567 (+) 657 WP_243821016.1 hypothetical protein -
  MTX16_RS27130 - 5309727..5309909 (+) 183 WP_243821017.1 hypothetical protein -
  MTX16_RS27135 - 5309926..5310408 (+) 483 WP_044797991.1 ArpU family phage packaging/lysis transcriptional regulator -
  MTX16_RS27140 - 5310408..5310950 (+) 543 WP_044797992.1 site-specific integrase -
  MTX16_RS27145 - 5311225..5311683 (+) 459 WP_044797993.1 hypothetical protein -
  MTX16_RS27150 - 5312160..5312924 (+) 765 WP_243821018.1 hypothetical protein -
  MTX16_RS27155 - 5313026..5313703 (+) 678 WP_243821019.1 YukJ family protein -
  MTX16_RS27160 - 5314152..5314364 (+) 213 WP_243821020.1 hypothetical protein -
  MTX16_RS27165 - 5314498..5314752 (+) 255 WP_243821021.1 hypothetical protein -
  MTX16_RS27170 - 5314742..5315119 (+) 378 WP_243821022.1 HNH endonuclease -
  MTX16_RS27175 - 5315245..5315748 (+) 504 WP_119683442.1 phage terminase small subunit P27 family -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10199.84 Da        Isoelectric Point: 5.1693

>NTDB_id=670304 MTX16_RS27060 WP_243821008.1 5297789..5298067(+) (abrB) [Bacillus thuringiensis strain LX43]
MKNTGVARKVDELGRVVIPVELRRTLGIVEGTALDFHVEDENIVLRKYEKSCFITGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGMAHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=670304 MTX16_RS27060 WP_243821008.1 5297789..5298067(+) (abrB) [Bacillus thuringiensis strain LX43]
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGATGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGTACGGCACTAGATTTTCATGTTGAAGATGAAAACATTGTTCTAAGAAAATATGAAAAGTCATGCTTTA
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA

Domains

Predicted by InterproScan.

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-50)

AbrB C-terminal domain (AbrB_C)

(52-86)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

59.77

94.565

0.565