Detailed information
Bioinformatically predicted
Overview
| Name | comB2 | Type | Machinery gene |
| Locus tag | MPG67_RS02505 | Genome accession | NZ_CP094156 |
| Coordinates | 504465..504749 (-) | Length | 94 a.a. |
| NCBI ID | WP_000736478.1 | Uniprot ID | - |
| Organism | Helicobacter pylori strain Hpfe005 | ||
| Function | transformation-associated type IV transport system (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 457796..548136 | 504465..504749 | within | 0 |
Gene organization within MGE regions
Location: 457796..548136
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MPG67_RS02310 (MPG67_02310) | - | 458075..459946 (+) | 1872 | WP_245051137.1 | mechanosensitive ion channel family protein | - |
| MPG67_RS02315 (MPG67_02315) | cfaS | 459949..461118 (-) | 1170 | WP_000623788.1 | cyclopropane fatty acid synthase | - |
| MPG67_RS02320 (MPG67_02320) | metG | 461287..463239 (+) | 1953 | WP_245051139.1 | methionine--tRNA ligase | - |
| MPG67_RS02325 (MPG67_02325) | - | 463240..464247 (+) | 1008 | WP_245073057.1 | ferrochelatase | - |
| MPG67_RS02330 (MPG67_02330) | cmoB | 464251..465036 (+) | 786 | WP_048944001.1 | tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB | - |
| MPG67_RS02335 (MPG67_02335) | - | 465053..465481 (+) | 429 | WP_245051143.1 | PaaI family thioesterase | - |
| MPG67_RS02340 (MPG67_02340) | - | 465486..466655 (+) | 1170 | WP_245051145.1 | glycosyltransferase family 4 protein | - |
| MPG67_RS02345 (MPG67_02345) | speA | 466670..468517 (+) | 1848 | WP_245051147.1 | arginine decarboxylase | - |
| MPG67_RS02350 (MPG67_02350) | - | 468611..469505 (-) | 895 | Protein_453 | hypothetical protein | - |
| MPG67_RS02355 (MPG67_02355) | - | 469611..470738 (-) | 1128 | Protein_454 | hypothetical protein | - |
| MPG67_RS02360 (MPG67_02360) | - | 471557..473593 (+) | 2037 | WP_245073059.1 | relaxase/mobilization nuclease domain-containing protein | - |
| MPG67_RS02365 (MPG67_02365) | - | 474675..475742 (+) | 1068 | WP_245073061.1 | tyrosine-type recombinase/integrase | - |
| MPG67_RS02370 (MPG67_02370) | ctkA | 476056..477033 (-) | 978 | WP_245073063.1 | serine/threonine-protein kinase CtkA | - |
| MPG67_RS02375 (MPG67_02375) | - | 477265..477993 (+) | 729 | WP_245073065.1 | hypothetical protein | - |
| MPG67_RS02380 (MPG67_02380) | - | 478015..479271 (-) | 1257 | WP_245073067.1 | hypothetical protein | - |
| MPG67_RS02385 (MPG67_02385) | - | 479268..480518 (-) | 1251 | WP_245073069.1 | P-type conjugative transfer protein TrbL | - |
| MPG67_RS02390 (MPG67_02390) | - | 480515..481948 (-) | 1434 | WP_245073071.1 | toprim domain-containing protein | - |
| MPG67_RS02395 (MPG67_02395) | - | 481958..483835 (-) | 1878 | WP_245073073.1 | hypothetical protein | - |
| MPG67_RS02400 (MPG67_02400) | - | 483835..484902 (-) | 1068 | WP_245073075.1 | ArdC-like ssDNA-binding domain-containing protein | - |
| MPG67_RS02405 (MPG67_02405) | - | 484903..485067 (-) | 165 | WP_000189756.1 | hypothetical protein | - |
| MPG67_RS07715 | - | 485704..485811 (+) | 108 | WP_342370385.1 | division plane positioning ATPase MipZ | - |
| MPG67_RS02415 (MPG67_02415) | - | 485873..486256 (+) | 384 | WP_245073330.1 | hypothetical protein | - |
| MPG67_RS02420 (MPG67_02420) | - | 486234..486803 (+) | 570 | WP_245073077.1 | hypothetical protein | - |
| MPG67_RS02425 (MPG67_02425) | - | 486926..487726 (-) | 801 | WP_245073079.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| MPG67_RS02430 (MPG67_02430) | - | 487696..488166 (-) | 471 | WP_000965788.1 | hypothetical protein | - |
| MPG67_RS02435 (MPG67_02435) | - | 488221..490284 (-) | 2064 | WP_245073081.1 | type IA DNA topoisomerase | - |
| MPG67_RS02440 (MPG67_02440) | - | 490274..492229 (-) | 1956 | WP_245073083.1 | type IV secretory system conjugative DNA transfer family protein | - |
| MPG67_RS02445 (MPG67_02445) | - | 492226..492744 (-) | 519 | WP_245073085.1 | replication regulatory RepB family protein | - |
| MPG67_RS02450 (MPG67_02450) | - | 492741..493685 (-) | 945 | WP_245073087.1 | CpaF/VirB11 family protein | - |
| MPG67_RS02455 (MPG67_02455) | - | 493690..493962 (-) | 273 | WP_245073088.1 | hypothetical protein | - |
| MPG67_RS02460 (MPG67_02460) | - | 493980..494957 (-) | 978 | WP_245073089.1 | hypothetical protein | - |
| MPG67_RS02465 (MPG67_02465) | - | 494970..497213 (-) | 2244 | WP_245073090.1 | collagen-like protein | - |
| MPG67_RS02470 (MPG67_02470) | comB10 | 497197..498399 (-) | 1203 | WP_245073091.1 | DNA type IV secretion system protein ComB10 | Machinery gene |
| MPG67_RS02475 (MPG67_02475) | - | 498396..500072 (-) | 1677 | WP_245073092.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| MPG67_RS02480 (MPG67_02480) | - | 500069..501238 (-) | 1170 | WP_245073094.1 | VirB8/TrbF family protein | - |
| MPG67_RS02485 (MPG67_02485) | - | 501231..501365 (-) | 135 | WP_000738749.1 | hypothetical protein | - |
| MPG67_RS02490 (MPG67_02490) | - | 501362..503944 (-) | 2583 | WP_245073096.1 | VirB4 family type IV secretion/conjugal transfer ATPase | - |
| MPG67_RS02495 (MPG67_02495) | - | 503944..504180 (-) | 237 | WP_245073098.1 | hypothetical protein | - |
| MPG67_RS02500 (MPG67_02500) | comB3 | 504191..504454 (-) | 264 | WP_001177712.1 | hypothetical protein | Machinery gene |
| MPG67_RS02505 (MPG67_02505) | comB2 | 504465..504749 (-) | 285 | WP_000736478.1 | TrbC/VirB2 family protein | Machinery gene |
| MPG67_RS02510 (MPG67_02510) | - | 504746..505225 (-) | 480 | WP_000571125.1 | hypothetical protein | - |
| MPG67_RS02515 (MPG67_02515) | - | 505329..506117 (-) | 789 | WP_245073100.1 | integrase | - |
| MPG67_RS02525 (MPG67_02525) | - | 506171..506894 (-) | 724 | Protein_487 | hypothetical protein | - |
| MPG67_RS02530 (MPG67_02530) | - | 506938..507927 (-) | 990 | WP_245051149.1 | hypothetical protein | - |
| MPG67_RS02535 (MPG67_02535) | - | 507983..509709 (-) | 1727 | Protein_489 | DUF262 domain-containing protein | - |
| MPG67_RS07720 | - | 514443..514643 (+) | 201 | WP_245051152.1 | hypothetical protein | - |
| MPG67_RS02550 (MPG67_02550) | - | 514636..515460 (+) | 825 | WP_000343481.1 | mechanosensitive ion channel family protein | - |
| MPG67_RS02555 (MPG67_02555) | - | 515510..515671 (+) | 162 | WP_180389345.1 | hypothetical protein | - |
| MPG67_RS02560 (MPG67_02560) | - | 515858..516046 (+) | 189 | WP_245073107.1 | hypothetical protein | - |
| MPG67_RS02565 (MPG67_02565) | ftsZ | 516381..517538 (-) | 1158 | WP_000233641.1 | cell division protein FtsZ | - |
| MPG67_RS02570 (MPG67_02570) | ftsA | 517673..519154 (-) | 1482 | WP_245073108.1 | cell division protein FtsA | - |
| MPG67_RS02575 (MPG67_02575) | - | 519170..520633 (-) | 1464 | WP_245051156.1 | peptidylprolyl isomerase | - |
| MPG67_RS02580 (MPG67_02580) | - | 520763..522073 (+) | 1311 | WP_245073109.1 | adenosylmethionine--8-amino-7-oxononanoate transaminase | - |
| MPG67_RS02585 (MPG67_02585) | gatC | 522160..522441 (-) | 282 | WP_001165182.1 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC | - |
| MPG67_RS02590 (MPG67_02590) | gpmI | 522456..523931 (-) | 1476 | WP_245073110.1 | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase | - |
| MPG67_RS02595 (MPG67_02595) | - | 523944..524996 (-) | 1053 | WP_245073111.1 | hypothetical protein | - |
| MPG67_RS02600 (MPG67_02600) | glyS | 525108..527210 (+) | 2103 | WP_245073112.1 | glycine--tRNA ligase subunit beta | - |
| MPG67_RS02605 (MPG67_02605) | - | 527200..528495 (+) | 1296 | WP_245073114.1 | TolC family protein | - |
| MPG67_RS02610 (MPG67_02610) | - | 528492..529571 (+) | 1080 | WP_245051171.1 | efflux RND transporter periplasmic adaptor subunit | - |
| MPG67_RS02615 (MPG67_02615) | - | 529571..532630 (+) | 3060 | WP_245073116.1 | efflux RND transporter permease subunit | - |
| MPG67_RS02620 (MPG67_02620) | - | 532641..532922 (+) | 282 | WP_000880314.1 | DUF3240 family protein | - |
| MPG67_RS02625 (MPG67_02625) | - | 532990..533277 (+) | 288 | WP_180657224.1 | virulence factor | - |
| MPG67_RS02630 (MPG67_02630) | - | 533486..533737 (+) | 252 | WP_245051175.1 | hypothetical protein | - |
| MPG67_RS02635 (MPG67_02635) | - | 533863..534243 (+) | 381 | WP_245051177.1 | hypothetical protein | - |
| MPG67_RS02640 (MPG67_02640) | - | 534228..534371 (+) | 144 | WP_231844774.1 | hypothetical protein | - |
| MPG67_RS02645 (MPG67_02645) | - | 534364..535158 (+) | 795 | WP_245051179.1 | dynamin family protein | - |
| MPG67_RS02650 (MPG67_02650) | - | 535345..535491 (+) | 147 | WP_162979703.1 | hypothetical protein | - |
| MPG67_RS02655 (MPG67_02655) | - | 536504..537442 (+) | 939 | WP_000401730.1 | NAD(P)H-dependent glycerol-3-phosphate dehydrogenase | - |
| MPG67_RS02660 (MPG67_02660) | glyQ | 537456..538352 (+) | 897 | WP_050828767.1 | glycine--tRNA ligase subunit alpha | - |
| MPG67_RS02665 (MPG67_02665) | - | 538354..539085 (+) | 732 | WP_245051183.1 | Nif3-like dinuclear metal center hexameric protein | - |
| MPG67_RS02670 (MPG67_02670) | - | 539095..539859 (+) | 765 | WP_245073118.1 | zinc ribbon domain-containing protein | - |
| MPG67_RS02675 (MPG67_02675) | waaA | 539860..541041 (+) | 1182 | WP_245051186.1 | lipid IV(A) 3-deoxy-D-manno-octulosonic acid transferase | - |
| MPG67_RS02680 (MPG67_02680) | - | 541055..541783 (+) | 729 | WP_245051187.1 | RluA family pseudouridine synthase | - |
| MPG67_RS02685 (MPG67_02685) | lgt | 541793..542647 (+) | 855 | WP_017282266.1 | prolipoprotein diacylglyceryl transferase | - |
| MPG67_RS02690 (MPG67_02690) | rdxA | 542644..543276 (+) | 633 | WP_245073120.1 | oxygen-insensitive NAD(P)H-dependent oxidoreductase RdxA | - |
| MPG67_RS02695 (MPG67_02695) | - | 543348..543914 (+) | 567 | WP_245051189.1 | hypothetical protein | - |
| MPG67_RS02700 (MPG67_02700) | - | 543916..544572 (-) | 657 | WP_245051190.1 | nicotinamide-nucleotide amidohydrolase family protein | - |
| MPG67_RS02705 (MPG67_02705) | recO | 544583..545197 (-) | 615 | WP_014536554.1 | recombination protein RecO | - |
| MPG67_RS02710 (MPG67_02710) | accD | 545278..546147 (+) | 870 | WP_180475281.1 | acetyl-CoA carboxylase, carboxyltransferase subunit beta | - |
| MPG67_RS02715 (MPG67_02715) | rlmH | 546161..546613 (+) | 453 | WP_245051192.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| MPG67_RS02720 (MPG67_02720) | - | 546623..547636 (+) | 1014 | WP_245073122.1 | LapA family protein | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10683.00 Da Isoelectric Point: 10.9123
>NTDB_id=667734 MPG67_RS02505 WP_000736478.1 504465..504749(-) (comB2) [Helicobacter pylori strain Hpfe005]
MKKLSHFRKLIAFLGFSPLLLQADMTTFFNSIEQQLTSPTAKGILMVIFLGLAIFIWKNLDRWKEILMTVLAIAIGAAIF
FKAPALANWFMSIF
MKKLSHFRKLIAFLGFSPLLLQADMTTFFNSIEQQLTSPTAKGILMVIFLGLAIFIWKNLDRWKEILMTVLAIAIGAAIF
FKAPALANWFMSIF
Nucleotide
Download Length: 285 bp
>NTDB_id=667734 MPG67_RS02505 WP_000736478.1 504465..504749(-) (comB2) [Helicobacter pylori strain Hpfe005]
ATGAAAAAATTAAGTCATTTTAGAAAGCTCATCGCCTTTTTAGGTTTTTCACCACTTTTACTACAAGCGGATATGACTAC
CTTTTTTAATAGTATTGAACAACAACTCACTAGCCCCACCGCTAAGGGTATTTTGATGGTCATTTTTTTAGGGCTTGCTA
TTTTTATATGGAAAAATTTAGACAGATGGAAAGAAATCTTAATGACAGTCCTTGCTATTGCCATAGGCGCTGCAATCTTT
TTTAAAGCCCCAGCCTTAGCTAATTGGTTTATGAGTATTTTTTAA
ATGAAAAAATTAAGTCATTTTAGAAAGCTCATCGCCTTTTTAGGTTTTTCACCACTTTTACTACAAGCGGATATGACTAC
CTTTTTTAATAGTATTGAACAACAACTCACTAGCCCCACCGCTAAGGGTATTTTGATGGTCATTTTTTTAGGGCTTGCTA
TTTTTATATGGAAAAATTTAGACAGATGGAAAGAAATCTTAATGACAGTCCTTGCTATTGCCATAGGCGCTGCAATCTTT
TTTAAAGCCCCAGCCTTAGCTAATTGGTTTATGAGTATTTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comB2 | Helicobacter pylori 26695 |
57.143 |
96.809 |
0.553 |