Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG51_RS00710 Genome accession   NZ_CP094145
Coordinates   149589..149714 (+) Length   41 a.a.
NCBI ID   WP_140483961.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe028     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 144589..154714
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG51_RS00685 (MPG51_00685) - 144651..146873 (+) 2223 WP_245034333.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG51_RS00690 (MPG51_00690) panD 146863..147213 (+) 351 WP_245034334.1 aspartate 1-decarboxylase -
  MPG51_RS00695 (MPG51_00695) - 147224..147517 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPG51_RS00700 (MPG51_00700) - 147517..148512 (+) 996 WP_245034938.1 PDZ domain-containing protein -
  MPG51_RS00705 (MPG51_00705) comB6 148518..149573 (+) 1056 WP_245034940.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG51_RS00710 (MPG51_00710) comB7 149589..149714 (+) 126 WP_140483961.1 comB7 lipoprotein Machinery gene
  MPG51_RS00715 (MPG51_00715) comB8 149711..150454 (+) 744 WP_245034336.1 virB8 family protein Machinery gene
  MPG51_RS00720 (MPG51_00720) comB9 150454..151416 (+) 963 WP_245034338.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG51_RS00725 (MPG51_00725) comB10 151409..152545 (+) 1137 WP_245034340.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG51_RS00730 (MPG51_00730) - 152615..154027 (+) 1413 WP_245034342.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4770.78 Da        Isoelectric Point: 9.3278

>NTDB_id=667569 MPG51_RS00710 WP_140483961.1 149589..149714(+) (comB7) [Helicobacter pylori strain Hpfe028]
MRIFSVIMGIMLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667569 MPG51_RS00710 WP_140483961.1 149589..149714(+) (comB7) [Helicobacter pylori strain Hpfe028]
ATGAGAATTTTTTCTGTCATTATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

80.488

100

0.805

Multiple sequence alignment