Detailed information
Bioinformatically predicted
Overview
| Name | dprB | Type | Machinery gene |
| Locus tag | MPF97_RS05430 | Genome accession | NZ_CP094093 |
| Coordinates | 1146772..1147176 (-) | Length | 134 a.a. |
| NCBI ID | WP_245102075.1 | Uniprot ID | - |
| Organism | Helicobacter pylori strain Hpfe085 | ||
| Function | homologous recombination (predicted from homology) Homologous recombination |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1101426..1148219 | 1146772..1147176 | within | 0 |
Gene organization within MGE regions
Location: 1101426..1148219
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MPF97_RS05235 (MPF97_05235) | - | 1102192..1102876 (-) | 685 | Protein_1019 | DUF3226 domain-containing protein | - |
| MPF97_RS05240 (MPF97_05240) | - | 1102869..1104053 (-) | 1185 | WP_245102026.1 | ATP/GTP-binding protein | - |
| MPF97_RS05245 (MPF97_05245) | - | 1104112..1104732 (-) | 621 | WP_245102028.1 | restriction endonuclease | - |
| MPF97_RS05250 (MPF97_05250) | - | 1104736..1105359 (-) | 624 | WP_180672207.1 | neuraminyllactose-binding hemagglutinin family protein | - |
| MPF97_RS05255 (MPF97_05255) | - | 1105353..1107008 (-) | 1656 | WP_245102030.1 | ABC transporter ATP-binding protein | - |
| MPF97_RS05260 (MPF97_05260) | hofB | 1107100..1108539 (-) | 1440 | WP_245102032.1 | outer membrane beta-barrel protein HofB | - |
| MPF97_RS05265 (MPF97_05265) | pyrB | 1108835..1109758 (-) | 924 | WP_245102034.1 | aspartate carbamoyltransferase | - |
| MPF97_RS05270 (MPF97_05270) | - | 1109825..1110340 (+) | 516 | WP_000523557.1 | hypothetical protein | - |
| MPF97_RS05275 (MPF97_05275) | - | 1110340..1111047 (+) | 708 | WP_245102036.1 | TlyA family RNA methyltransferase | - |
| MPF97_RS05280 (MPF97_05280) | - | 1111013..1111855 (+) | 843 | WP_220999225.1 | bifunctional riboflavin kinase/FAD synthetase | - |
| MPF97_RS05285 (MPF97_05285) | tkt | 1111902..1113827 (+) | 1926 | WP_245102038.1 | transketolase | - |
| MPF97_RS05290 (MPF97_05290) | - | 1113824..1116160 (+) | 2337 | WP_245102040.1 | PD-(D/E)XK nuclease family protein | - |
| MPF97_RS05295 (MPF97_05295) | - | 1116157..1118715 (+) | 2559 | WP_245102041.1 | DNA translocase FtsK | - |
| MPF97_RS05300 (MPF97_05300) | - | 1118878..1120164 (+) | 1287 | WP_245102042.1 | MFS transporter | - |
| MPF97_RS05305 (MPF97_05305) | - | 1120221..1121030 (+) | 810 | WP_021308501.1 | flagellar hook-basal body protein | - |
| MPF97_RS05310 (MPF97_05310) | - | 1121332..1121802 (-) | 471 | WP_000371062.1 | group I intron-associated PD-(D/E)XK endonuclease | - |
| MPF97_RS05315 (MPF97_05315) | - | 1121795..1122724 (-) | 930 | WP_245102043.1 | DNA cytosine methyltransferase | - |
| MPF97_RS05320 (MPF97_05320) | lepA | 1122733..1124523 (-) | 1791 | WP_180403563.1 | translation elongation factor 4 | - |
| MPF97_RS05325 (MPF97_05325) | dxs | 1124538..1126388 (-) | 1851 | WP_245102044.1 | 1-deoxy-D-xylulose-5-phosphate synthase | - |
| MPF97_RS05330 (MPF97_05330) | fliH | 1126391..1127167 (-) | 777 | WP_245102045.1 | flagellar assembly protein FliH | - |
| MPF97_RS05335 (MPF97_05335) | fliG | 1127154..1128185 (-) | 1032 | WP_245102047.1 | flagellar motor switch protein FliG | - |
| MPF97_RS05340 (MPF97_05340) | fliF | 1128204..1129907 (-) | 1704 | WP_245102049.1 | flagellar basal-body MS-ring/collar protein FliF | - |
| MPF97_RS05345 (MPF97_05345) | - | 1129951..1130619 (-) | 669 | WP_245102051.1 | PAP2 family protein | - |
| MPF97_RS05350 (MPF97_05350) | pyrG | 1130878..1132494 (+) | 1617 | WP_000373153.1 | CTP synthase (glutamine hydrolyzing) | - |
| MPF97_RS05355 (MPF97_05355) | recJ | 1132503..1134053 (+) | 1551 | WP_245102053.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| MPF97_RS05360 (MPF97_05360) | - | 1134053..1134934 (+) | 882 | WP_245102055.1 | RluA family pseudouridine synthase | - |
| MPF97_RS05365 (MPF97_05365) | - | 1135170..1135421 (+) | 252 | WP_000006537.1 | hypothetical protein | - |
| MPF97_RS05370 (MPF97_05370) | - | 1135393..1136196 (+) | 804 | WP_140486252.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| MPF97_RS05375 (MPF97_05375) | - | 1136510..1137577 (-) | 1068 | WP_245102057.1 | tyrosine-type recombinase/integrase | - |
| MPF97_RS05380 (MPF97_05380) | - | 1138664..1140700 (-) | 2037 | WP_245102059.1 | relaxase/mobilization nuclease domain-containing protein | - |
| MPF97_RS05385 (MPF97_05385) | - | 1141670..1142704 (-) | 1035 | WP_245102061.1 | hypothetical protein | - |
| MPF97_RS05390 (MPF97_05390) | - | 1142694..1143479 (-) | 786 | WP_245102063.1 | hypothetical protein | - |
| MPF97_RS05395 (MPF97_05395) | - | 1143479..1143865 (-) | 387 | WP_245102065.1 | DUF1294 domain-containing protein | - |
| MPF97_RS07550 | - | 1143945..1144076 (-) | 132 | WP_280635885.1 | hypothetical protein | - |
| MPF97_RS05400 (MPF97_05400) | - | 1144201..1144362 (-) | 162 | WP_014536434.1 | lysozyme | - |
| MPF97_RS05405 (MPF97_05405) | - | 1144382..1144528 (-) | 147 | WP_245102067.1 | hypothetical protein | - |
| MPF97_RS05410 (MPF97_05410) | - | 1144552..1144875 (-) | 324 | WP_245102069.1 | lysozyme | - |
| MPF97_RS05415 (MPF97_05415) | - | 1144886..1145446 (-) | 561 | WP_245102071.1 | hypothetical protein | - |
| MPF97_RS05420 (MPF97_05420) | - | 1145430..1145768 (-) | 339 | WP_000699911.1 | hypothetical protein | - |
| MPF97_RS05425 (MPF97_05425) | - | 1145958..1146644 (-) | 687 | WP_245102073.1 | tetratricopeptide repeat protein | - |
| MPF97_RS05430 (MPF97_05430) | dprB | 1146772..1147176 (-) | 405 | WP_245102075.1 | Holliday junction resolvase RuvX | Machinery gene |
| MPF97_RS05435 (MPF97_05435) | dprA | 1147173..1147973 (-) | 801 | WP_245102077.1 | DNA-processing protein DprA | Machinery gene |
| MPF97_RS05440 (MPF97_05440) | minE | 1147985..1148218 (-) | 234 | WP_021304603.1 | cell division topological specificity factor MinE | - |
Sequence
Protein
Download Length: 134 a.a. Molecular weight: 15257.74 Da Isoelectric Point: 8.7002
>NTDB_id=666738 MPF97_RS05430 WP_245102075.1 1146772..1147176(-) (dprB) [Helicobacter pylori strain Hpfe085]
MILACDVGLKRIGIAMLLNGVILPLEAILRQNRNQASRDLSDLLREKNIQVLVVGKPNESYADTNARIEYFIKLLDFNGE
IVFINEDRSSIEAYENLGHLGKKNKRLAIKDGRLDSLSACRILERYCQQVLKDR
MILACDVGLKRIGIAMLLNGVILPLEAILRQNRNQASRDLSDLLREKNIQVLVVGKPNESYADTNARIEYFIKLLDFNGE
IVFINEDRSSIEAYENLGHLGKKNKRLAIKDGRLDSLSACRILERYCQQVLKDR
Nucleotide
Download Length: 405 bp
>NTDB_id=666738 MPF97_RS05430 WP_245102075.1 1146772..1147176(-) (dprB) [Helicobacter pylori strain Hpfe085]
GTGATTTTGGCATGCGATGTGGGCTTAAAACGCATTGGGATCGCTATGCTTTTGAACGGCGTTATTTTGCCTTTAGAAGC
GATCTTACGCCAAAATAGGAATCAGGCCTCTAGGGATTTGAGCGATTTGTTGAGGGAAAAAAACATTCAAGTGCTGGTGG
TGGGCAAGCCCAATGAAAGCTATGCGGACACGAACGCGCGCATTGAATATTTCATCAAGCTTTTGGATTTTAATGGCGAA
ATCGTTTTTATTAATGAAGACAGATCCAGTATAGAAGCCTATGAAAATTTAGGGCATTTGGGTAAGAAAAACAAGCGGCT
CGCTATCAAAGACGGCCGGCTAGACTCTTTGAGCGCTTGCAGGATCTTGGAGCGCTATTGCCAGCAGGTTTTAAAAGATC
GCTAG
GTGATTTTGGCATGCGATGTGGGCTTAAAACGCATTGGGATCGCTATGCTTTTGAACGGCGTTATTTTGCCTTTAGAAGC
GATCTTACGCCAAAATAGGAATCAGGCCTCTAGGGATTTGAGCGATTTGTTGAGGGAAAAAAACATTCAAGTGCTGGTGG
TGGGCAAGCCCAATGAAAGCTATGCGGACACGAACGCGCGCATTGAATATTTCATCAAGCTTTTGGATTTTAATGGCGAA
ATCGTTTTTATTAATGAAGACAGATCCAGTATAGAAGCCTATGAAAATTTAGGGCATTTGGGTAAGAAAAACAAGCGGCT
CGCTATCAAAGACGGCCGGCTAGACTCTTTGAGCGCTTGCAGGATCTTGGAGCGCTATTGCCAGCAGGTTTTAAAAGATC
GCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| dprB | Helicobacter pylori 26695 |
92.537 |
100 |
0.925 |