Detailed information
Bioinformatically predicted
Overview
| Name | comB2 | Type | Machinery gene |
| Locus tag | MPG12_RS00625 | Genome accession | NZ_CP094062 |
| Coordinates | 128635..128919 (+) | Length | 94 a.a. |
| NCBI ID | WP_000736106.1 | Uniprot ID | T0F3N0 |
| Organism | Helicobacter pylori strain Hpfe118 | ||
| Function | transformation-associated type IV transport system (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 98015..189076 | 128635..128919 | within | 0 |
Gene organization within MGE regions
Location: 98015..189076
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MPG12_RS00470 (MPG12_00470) | purU | 98791..99672 (+) | 882 | WP_245045930.1 | formyltetrahydrofolate deformylase | - |
| MPG12_RS00475 (MPG12_00475) | - | 99700..100221 (+) | 522 | Protein_93 | restriction endonuclease subunit S | - |
| MPG12_RS00480 (MPG12_00480) | hpnL | 100702..100854 (-) | 153 | Protein_94 | nickel-binding protein HpnL | - |
| MPG12_RS00485 (MPG12_00485) | rsmA | 101170..101985 (+) | 816 | WP_245030572.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| MPG12_RS00490 (MPG12_00490) | - | 102023..104107 (+) | 2085 | WP_180512086.1 | ribonuclease J | - |
| MPG12_RS00495 (MPG12_00495) | - | 104091..105080 (+) | 990 | WP_245045932.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| MPG12_RS00500 (MPG12_00500) | rlmN | 105077..106150 (+) | 1074 | WP_245045934.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| MPG12_RS00505 (MPG12_00505) | - | 106325..106444 (+) | 120 | Protein_99 | hypothetical protein | - |
| MPG12_RS00510 (MPG12_00510) | - | 106395..106604 (+) | 210 | WP_245045936.1 | hypothetical protein | - |
| MPG12_RS00515 (MPG12_00515) | - | 106808..107428 (-) | 621 | WP_245045938.1 | hypothetical protein | - |
| MPG12_RS00520 (MPG12_00520) | - | 107530..107787 (+) | 258 | WP_001217156.1 | RNA-binding S4 domain-containing protein | - |
| MPG12_RS00525 (MPG12_00525) | ileS | 107820..110582 (+) | 2763 | WP_245045940.1 | isoleucine--tRNA ligase | - |
| MPG12_RS00530 (MPG12_00530) | - | 110598..111512 (+) | 915 | WP_245045942.1 | type II/IV secretion system ATPase subunit | - |
| MPG12_RS00535 (MPG12_00535) | fliI | 111513..112817 (+) | 1305 | WP_001128779.1 | flagellar protein export ATPase FliI | - |
| MPG12_RS00540 (MPG12_00540) | fliQ | 112828..113094 (+) | 267 | WP_000445741.1 | flagellar biosynthesis protein FliQ | - |
| MPG12_RS00545 (MPG12_00545) | - | 113098..113877 (+) | 780 | WP_245045944.1 | UDP-N-acetylmuramate dehydrogenase | - |
| MPG12_RS00550 (MPG12_00550) | - | 113922..114779 (-) | 858 | WP_245046499.1 | phosphoethanolamine transferase | - |
| MPG12_RS00555 (MPG12_00555) | - | 114784..115593 (-) | 810 | WP_245045946.1 | sulfatase-like hydrolase/transferase | - |
| MPG12_RS00560 (MPG12_00560) | - | 115603..116706 (-) | 1104 | WP_245045947.1 | glycosyltransferase family 8 protein | - |
| MPG12_RS00565 (MPG12_00565) | miaA | 116711..117649 (-) | 939 | WP_245045949.1 | tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA | - |
| MPG12_RS00570 (MPG12_00570) | rsfS | 117612..117953 (-) | 342 | WP_001042226.1 | ribosome silencing factor | - |
| MPG12_RS00575 (MPG12_00575) | queF | 118012..118452 (+) | 441 | WP_245045951.1 | preQ(1) synthase | - |
| MPG12_RS00580 (MPG12_00580) | - | 118568..119489 (-) | 922 | Protein_114 | hypothetical protein | - |
| MPG12_RS00585 (MPG12_00585) | - | 119629..121461 (-) | 1833 | WP_245045952.1 | DUF262 domain-containing protein | - |
| MPG12_RS00590 (MPG12_00590) | - | 121461..121943 (-) | 483 | WP_245045954.1 | hypothetical protein | - |
| MPG12_RS00595 (MPG12_00595) | - | 122088..122684 (-) | 597 | WP_245045956.1 | hypothetical protein | - |
| MPG12_RS00610 (MPG12_00610) | - | 126838..126992 (-) | 155 | Protein_118 | IS1595 family transposase | - |
| MPG12_RS00615 (MPG12_00615) | - | 127267..128055 (+) | 789 | WP_245045958.1 | integrase | - |
| MPG12_RS00620 (MPG12_00620) | - | 128159..128638 (+) | 480 | WP_231254044.1 | hypothetical protein | - |
| MPG12_RS00625 (MPG12_00625) | comB2 | 128635..128919 (+) | 285 | WP_000736106.1 | TrbC/VirB2 family protein | Machinery gene |
| MPG12_RS00630 (MPG12_00630) | comB3 | 128930..129193 (+) | 264 | WP_245045960.1 | competence protein ComB | Machinery gene |
| MPG12_RS00635 (MPG12_00635) | - | 129204..129440 (+) | 237 | WP_001183709.1 | hypothetical protein | - |
| MPG12_RS00640 (MPG12_00640) | - | 129440..132016 (+) | 2577 | WP_245045962.1 | VirB4 family type IV secretion/conjugal transfer ATPase | - |
| MPG12_RS00645 (MPG12_00645) | - | 132018..132152 (+) | 135 | WP_041200005.1 | hypothetical protein | - |
| MPG12_RS00650 (MPG12_00650) | - | 132145..133278 (+) | 1134 | WP_245045964.1 | VirB8/TrbF family protein | - |
| MPG12_RS00655 (MPG12_00655) | - | 133275..134950 (+) | 1676 | Protein_127 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| MPG12_RS00660 (MPG12_00660) | comB10 | 134947..136149 (+) | 1203 | WP_245045966.1 | DNA type IV secretion system protein ComB10 | Machinery gene |
| MPG12_RS00665 (MPG12_00665) | - | 136133..137122 (+) | 990 | Protein_129 | collagen-like protein | - |
| MPG12_RS00670 (MPG12_00670) | - | 137175..138503 (-) | 1329 | WP_245045968.1 | transposase | - |
| MPG12_RS00675 (MPG12_00675) | tnpA | 138540..138956 (+) | 417 | WP_100966189.1 | IS200/IS605 family transposase | - |
| MPG12_RS00680 (MPG12_00680) | - | 139091..140289 (+) | 1199 | Protein_132 | collagen-like protein | - |
| MPG12_RS00685 (MPG12_00685) | - | 140302..141279 (+) | 978 | WP_245045970.1 | hypothetical protein | - |
| MPG12_RS00690 (MPG12_00690) | - | 141297..141569 (+) | 273 | WP_180520989.1 | hypothetical protein | - |
| MPG12_RS00695 (MPG12_00695) | - | 141574..142518 (+) | 945 | WP_120836740.1 | CpaF/VirB11 family protein | - |
| MPG12_RS00700 (MPG12_00700) | - | 142515..143033 (+) | 519 | WP_096397345.1 | replication regulatory RepB family protein | - |
| MPG12_RS00705 (MPG12_00705) | - | 143030..145294 (+) | 2265 | WP_245045972.1 | type IV secretory system conjugative DNA transfer family protein | - |
| MPG12_RS00710 (MPG12_00710) | - | 145314..153921 (+) | 8608 | Protein_138 | SNF2-related protein | - |
| MPG12_RS00715 (MPG12_00715) | - | 154257..156326 (+) | 2070 | WP_245045974.1 | type IA DNA topoisomerase | - |
| MPG12_RS00720 (MPG12_00720) | - | 156381..156851 (+) | 471 | WP_000965788.1 | hypothetical protein | - |
| MPG12_RS00725 (MPG12_00725) | - | 156821..157621 (+) | 801 | WP_180461217.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| MPG12_RS00730 (MPG12_00730) | - | 157744..158316 (-) | 573 | WP_180461218.1 | hypothetical protein | - |
| MPG12_RS00735 (MPG12_00735) | - | 158974..159138 (+) | 165 | WP_000189755.1 | hypothetical protein | - |
| MPG12_RS00740 (MPG12_00740) | - | 159139..160207 (+) | 1069 | Protein_144 | ArdC family protein | - |
| MPG12_RS00745 (MPG12_00745) | - | 160207..162169 (+) | 1963 | Protein_145 | hypothetical protein | - |
| MPG12_RS00750 (MPG12_00750) | - | 162179..163612 (+) | 1434 | WP_245045976.1 | toprim domain-containing protein | - |
| MPG12_RS00755 (MPG12_00755) | - | 163609..164859 (+) | 1251 | WP_245045978.1 | P-type conjugative transfer protein TrbL | - |
| MPG12_RS00760 (MPG12_00760) | - | 164856..166112 (+) | 1257 | WP_245045980.1 | hypothetical protein | - |
| MPG12_RS00765 (MPG12_00765) | - | 166134..166863 (-) | 730 | Protein_149 | hypothetical protein | - |
| MPG12_RS00770 (MPG12_00770) | - | 167113..167772 (+) | 660 | WP_220841219.1 | CAAX protease | - |
| MPG12_RS00775 (MPG12_00775) | - | 168000..168251 (+) | 252 | WP_199497420.1 | hypothetical protein | - |
| MPG12_RS00780 (MPG12_00780) | - | 168223..169023 (+) | 801 | WP_220841194.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| MPG12_RS00785 (MPG12_00785) | - | 169337..170404 (-) | 1068 | WP_245045984.1 | tyrosine-type recombinase/integrase | - |
| MPG12_RS00790 (MPG12_00790) | - | 171500..173485 (-) | 1986 | WP_245045986.1 | relaxase/mobilization nuclease domain-containing protein | - |
| MPG12_RS00795 (MPG12_00795) | - | 174647..175525 (-) | 879 | WP_154442749.1 | YihY family inner membrane protein | - |
| MPG12_RS00800 (MPG12_00800) | - | 175525..176373 (-) | 849 | WP_096425264.1 | biotin synthase | - |
| MPG12_RS07875 | - | 176508..176647 (+) | 140 | Protein_157 | type III restriction endonuclease subunit R | - |
| MPG12_RS00805 (MPG12_00805) | - | 176685..179123 (+) | 2439 | WP_342368870.1 | DEAD/DEAH box helicase family protein | - |
| MPG12_RS00810 (MPG12_00810) | - | 179117..180961 (+) | 1845 | WP_245045988.1 | site-specific DNA-methyltransferase | - |
| MPG12_RS00815 (MPG12_00815) | - | 181086..181525 (+) | 440 | Protein_160 | DNA/RNA non-specific endonuclease | - |
| MPG12_RS00820 (MPG12_00820) | - | 181804..183084 (-) | 1281 | WP_245045990.1 | citrate synthase | - |
| MPG12_RS00825 (MPG12_00825) | icd | 183285..184562 (+) | 1278 | WP_245045992.1 | isocitrate dehydrogenase (NADP(+)) | - |
| MPG12_RS00830 (MPG12_00830) | - | 184633..185160 (+) | 528 | WP_245045994.1 | DUF1523 family protein | - |
| MPG12_RS00835 (MPG12_00835) | bioD | 185137..185793 (-) | 657 | WP_245045996.1 | dethiobiotin synthase | - |
| MPG12_RS00840 (MPG12_00840) | - | 185797..186096 (-) | 300 | WP_154434654.1 | hypothetical protein | - |
| MPG12_RS00845 (MPG12_00845) | - | 186136..186441 (-) | 306 | WP_180581285.1 | hypothetical protein | - |
| MPG12_RS00850 (MPG12_00850) | - | 186550..186963 (+) | 414 | WP_001023008.1 | universal stress protein | - |
| MPG12_RS00855 (MPG12_00855) | - | 186978..187253 (+) | 276 | WP_000784908.1 | ATP-dependent Clp protease adaptor ClpS | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10752.11 Da Isoelectric Point: 11.1589
>NTDB_id=666258 MPG12_RS00625 WP_000736106.1 128635..128919(+) (comB2) [Helicobacter pylori strain Hpfe118]
MKKLRHFRKLIAFLGFSPLLLQADMTTFFNSIEQQLTSPTAKGILMVIFLGLAIFIWKNLDRWKEILMTVLAIAIGAAIF
FKAPALANWFMSIF
MKKLRHFRKLIAFLGFSPLLLQADMTTFFNSIEQQLTSPTAKGILMVIFLGLAIFIWKNLDRWKEILMTVLAIAIGAAIF
FKAPALANWFMSIF
Nucleotide
Download Length: 285 bp
>NTDB_id=666258 MPG12_RS00625 WP_000736106.1 128635..128919(+) (comB2) [Helicobacter pylori strain Hpfe118]
ATGAAAAAATTAAGGCATTTTAGAAAGCTCATCGCCTTTTTAGGTTTTTCACCACTTTTACTACAAGCGGATATGACTAC
CTTTTTTAATAGCATTGAACAACAACTCACTAGCCCCACCGCTAAGGGTATTTTGATGGTCATTTTTTTAGGGCTTGCTA
TTTTTATATGGAAAAATTTAGACAGATGGAAAGAAATCTTAATGACAGTCCTTGCTATTGCCATAGGCGCTGCAATCTTT
TTTAAAGCCCCAGCCTTAGCTAATTGGTTTATGAGTATTTTTTAA
ATGAAAAAATTAAGGCATTTTAGAAAGCTCATCGCCTTTTTAGGTTTTTCACCACTTTTACTACAAGCGGATATGACTAC
CTTTTTTAATAGCATTGAACAACAACTCACTAGCCCCACCGCTAAGGGTATTTTGATGGTCATTTTTTTAGGGCTTGCTA
TTTTTATATGGAAAAATTTAGACAGATGGAAAGAAATCTTAATGACAGTCCTTGCTATTGCCATAGGCGCTGCAATCTTT
TTTAAAGCCCCAGCCTTAGCTAATTGGTTTATGAGTATTTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comB2 | Helicobacter pylori 26695 |
57.778 |
95.745 |
0.553 |